g.arboreum_cottongen_reftransV1_0010658, g.arboreum_cottongen_reftransV1_0010658 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010658
Unique Nameg.arboreum_cottongen_reftransV1_0010658
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1610
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0010658:1..1610 .
Chr12:93308985..93312066 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A0B0PRQ1_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_07457 PE=4 SV=1)

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 411/411 (100.00%), Postives = 411/411 (100.00%), Query Frame = -2
Query:  377 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS
Sbjct:  933 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1343          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A0D2VUD8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G017400 PE=4 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 403/411 (98.05%), Postives = 406/411 (98.78%), Query Frame = -2
Query:  377 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAG IKVTEAGEDIQETMDILVE GLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYL+ERLKALQEVNKEVRCSMDEDD+AKHIDKFLCPSQRSDMGVPLLLN SRLGNESC MLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGH+GSRPCRTLHDFAESNYLARLSF HRNSVS
Sbjct:  935 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGQIKVTEAGEDIQETMDILVETGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLVERLKALQEVNKEVRCSMDEDDKAKHIDKFLCPSQRSDMGVPLLLNLSRLGNESCNMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHDGSRPCRTLHDFAESNYLARLSFAHRNSVS 1345          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A061FRB8_THECC (SNF2 domain-containing protein / helicase domain-containing protein / F-box family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_045253 PE=4 SV=1)

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 385/411 (93.67%), Postives = 395/411 (96.11%), Query Frame = -2
Query:  377 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLP+VTPCRHLLCLDCVGLDSK+CTLPGCG LYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQST+SSKVAYL+ERLKALQEVNKE+RCSMDED++AKHIDK L PSQRS+MGVPLL N SR G ES K LP+KVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHS NKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAM GTIEEQM+EFLQDADACRKFLKEESQR   EGSR  RTLHDFAESNYLARLSFVHRNSVS
Sbjct:  937 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPVVTPCRHLLCLDCVGLDSKVCTLPGCGRLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTTSSKVAYLVERLKALQEVNKEIRCSMDEDNDAKHIDKLLWPSQRSNMGVPLLQNCSRHGKESYKTLPQKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSSNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMSGTIEEQMLEFLQDADACRKFLKEESQRPDREGSRTRRTLHDFAESNYLARLSFVHRNSVS 1347          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A061FS07_THECC (SNF2 domain-containing protein / helicase domain-containing protein / F-box family protein isoform 3 OS=Theobroma cacao GN=TCM_045253 PE=4 SV=1)

HSP 1 Score: 804.668 bits (2077), Expect = 0.000e+0
Identity = 385/411 (93.67%), Postives = 395/411 (96.11%), Query Frame = -2
Query:  377 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLP+VTPCRHLLCLDCVGLDSK+CTLPGCG LYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQST+SSKVAYL+ERLKALQEVNKE+RCSMDED++AKHIDK L PSQRS+MGVPLL N SR G ES K LP+KVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHS NKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAM GTIEEQM+EFLQDADACRKFLKEESQR   EGSR  RTLHDFAESNYLARLSFVHRNSVS
Sbjct:  772 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPVVTPCRHLLCLDCVGLDSKVCTLPGCGRLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTTSSKVAYLVERLKALQEVNKEIRCSMDEDNDAKHIDKLLWPSQRSNMGVPLLQNCSRHGKESYKTLPQKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSSNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMSGTIEEQMLEFLQDADACRKFLKEESQRPDREGSRTRRTLHDFAESNYLARLSFVHRNSVS 1182          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A0D2V0N4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G017400 PE=4 SV=1)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 383/411 (93.19%), Postives = 386/411 (93.92%), Query Frame = -2
Query:  377 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNSVS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAG IKVTEAGEDIQETMDILVE GLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYL+ERLKALQEVNKEVRCSMDEDD+AKHIDKFLCPSQRSDMGVPLLLN SRLGNESC MLPEKVLIFSQFLEHIHVIEQQ                    MKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGH+GSRPCRTLHDFAESNYLARLSF HRNSVS
Sbjct:  935 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGQIKVTEAGEDIQETMDILVETGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLVERLKALQEVNKEVRCSMDEDDKAKHIDKFLCPSQRSDMGVPLLLNLSRLGNESCNMLPEKVLIFSQFLEHIHVIEQQ--------------------MKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHDGSRPCRTLHDFAESNYLARLSFAHRNSVS 1325          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: B9RGB4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1452670 PE=4 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 328/408 (80.39%), Postives = 360/408 (88.24%), Query Frame = -2
Query:  386 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRN 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRS +IRNVRLSCCVAGHIKVT+AGEDIQETMD L E GLDP+SEEYA IKY L YGGNC RC EWCRLP+VTPCRHLLCLDCVGLDS+ CTLPGCG+LYEMQTP++L RPENPNPKWPVPKDLIELQPSYKQDDW+PDWQSTSSSKV+YL++R+K L E N E     D++ +AK+I + L PSQ  +    LL + SR  +ES K  PEKVLIFSQFLEHIHVIEQQLTFAGIKFAG+YSPMHS NKMKSLA FQ+D +C+ALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRP+ VETLAMRGTIEEQM+EFLQDAD CRK LKEE ++  HEG+RP R+LHDFAE NYLARLSFVH+N
Sbjct:  914 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSASIRNVRLSCCVAGHIKVTDAGEDIQETMDDLAEKGLDPISEEYALIKYYLQYGGNCLRCQEWCRLPVVTPCRHLLCLDCVGLDSEKCTLPGCGYLYEMQTPDSLTRPENPNPKWPVPKDLIELQPSYKQDDWDPDWQSTSSSKVSYLVQRMKVLLEANSE-SGHYDKEADAKNIKEHLYPSQIGESNA-LLQDCSRQSSESYKKAPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGLYSPMHSSNKMKSLATFQHDATCLALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPVQVETLAMRGTIEEQMLEFLQDADECRKLLKEEFRKPDHEGARPRRSLHDFAERNYLARLSFVHKN 1319          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A5BGE7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_032626 PE=4 SV=1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 323/409 (78.97%), Postives = 360/409 (88.02%), Query Frame = -2
Query:  383 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFR +TI+NVRLSCCVAGHIKVT+AGEDIQETMDILVENGLDP+S+EYAFIKYNLLYGG C RC EWCRLP++TPCRHLLCLDCV LDS+ CT PGCG+LYEMQ+PE L RPENPNPKWPVPKDLIELQPSYKQD W+PDWQSTSSSKV Y+++RLKALQE N++   +MDED + K ID+ +  S++++    L  +++RL +E+  + PEKVLIFSQFLEHIHVIEQQLT AGIKF+GMYSPMHS NKMKSL+ FQ+D  CMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPI VETLAMRGTIEEQM+EFLQDAD CR+FLKEE  +   EG R  R+LHDFAESNYLA LSFV  NS
Sbjct:  798 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRISTIKNVRLSCCVAGHIKVTDAGEDIQETMDILVENGLDPISDEYAFIKYNLLYGGACMRCKEWCRLPVITPCRHLLCLDCVALDSEKCTFPGCGNLYEMQSPEILTRPENPNPKWPVPKDLIELQPSYKQDTWDPDWQSTSSSKVTYIVKRLKALQEANRKSGYAMDEDSDIKDIDELVSLSEQNNCNALLQQDYTRLNDETSHISPEKVLIFSQFLEHIHVIEQQLTVAGIKFSGMYSPMHSSNKMKSLSTFQHDADCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIRVETLAMRGTIEEQMLEFLQDADECRRFLKEEFGKPYSEGVRAHRSLHDFAESNYLAHLSFVRTNS 1206          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: V4U415_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10004162mg PE=4 SV=1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 322/409 (78.73%), Postives = 356/409 (87.04%), Query Frame = -2
Query:  383 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRNS 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRN+RLSCCVAGHIKVT+AGEDIQETMD+LVENGLDPLS+EYAFIKYNLL GGNC RCNEWCRLP++TPCRH+LCLDCV +DS+ C+LPGCG LYEMQ+PE L RPENPNPKWPVPKDLIELQPSY+QDDWNPDWQSTSSSKVAYL+E+LK LQE N E+  + +ED   KHI++     Q S+    L  +  R   ES K LP+KV+IFSQFLEHIHVIEQQLT AGIKFAGMYSPMHS NK+KSL MF++D SC+ALLMDGSA+LGLDLSFVT VFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGT+EEQM+EFLQD D CR+ LKEE  +   EG+R  RTLHDFAESNYL+ LSFV  NS
Sbjct:  931 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNLRLSCCVAGHIKVTDAGEDIQETMDVLVENGLDPLSQEYAFIKYNLLNGGNCLRCNEWCRLPVITPCRHILCLDCVAMDSEKCSLPGCGFLYEMQSPEILTRPENPNPKWPVPKDLIELQPSYRQDDWNPDWQSTSSSKVAYLVEKLKVLQEANWEICYAFNEDSSVKHIEELPFTPQWSNTNTFLKQDLYRPNLESNKALPDKVIIFSQFLEHIHVIEQQLTVAGIKFAGMYSPMHSSNKIKSLDMFRHDASCLALLMDGSASLGLDLSFVTRVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTVEEQMLEFLQDTDRCRRLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTNS 1339          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: M5XQS9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa015535mg PE=4 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 318/411 (77.37%), Postives = 357/411 (86.86%), Query Frame = -2
Query:  386 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYK---QDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRN 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTI NVRLSCCVAGHIKVT+AGEDIQETMDIL E+GLDP SEEYAFIKYNLLYGGNC RC EWCRLP++TPCRHLLCLDCVGLDS+ CT PGCGHLYEM+TP+ L RPENPNPKWPVPKDLIELQPSYK   QD+W+PDWQSTSSSKVAY++++LKALQE N  V C +D+++ A   D  +C S+ S+      ++  +   ++ +   EKVL+FSQFLEHIHVIEQQLT AGIK+AGMYSPMHS NKMKSLAMFQ+D SC  LLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQV+SRAHRMGATRPIHVETLAMRGTIEEQM+EFLQDAD CR+FLKEE  +S  +G+R  R+LHDFAESNYL+++SFV  N
Sbjct:  918 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIGNVRLSCCVAGHIKVTDAGEDIQETMDILAEDGLDPTSEEYAFIKYNLLYGGNCIRCKEWCRLPVITPCRHLLCLDCVGLDSERCTYPGCGHLYEMETPDALTRPENPNPKWPVPKDLIELQPSYKQARQDNWDPDWQSTSSSKVAYVVQKLKALQEANSNVDCPLDDNNNAMRTDNLVCLSEMSNSKGLRQVHDFKRTTKTHETNLEKVLVFSQFLEHIHVIEQQLTIAGIKYAGMYSPMHSSNKMKSLAMFQHDASCTVLLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVVSRAHRMGATRPIHVETLAMRGTIEEQMLEFLQDADECRRFLKEEVGKSDPKGARTRRSLHDFAESNYLSQISFVRTN 1328          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Match: A0A0D2RW69_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G017400 PE=4 SV=1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 318/324 (98.15%), Postives = 320/324 (98.77%), Query Frame = -2
Query:  638 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDR 1609
            NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAG IKVTEAGEDIQETMDILVE GLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYL+ERLKALQEVNKEVRCSMDEDD+AKHIDKFLCPSQRSDMGVPLLLN SRLGNESC MLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDR
Sbjct:  935 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGQIKVTEAGEDIQETMDILVETGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLVERLKALQEVNKEVRCSMDEDDKAKHIDKFLCPSQRSDMGVPLLLNLSRLGNESCNMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDR 1258          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: FB304_ARATH (F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 285/408 (69.85%), Postives = 326/408 (79.90%), Query Frame = -2
Query:  386 NELVVTVRRNILMADWNDPSHVESLLNPKQWKFRSTTIRNVRLSCCVAGHIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYGGNCQRCNEWCRLPIVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKEESQRSGHEGSRPCRTLHDFAESNYLARLSFVHRN 1609
            NELV TVRRNIL+ADWNDPSHVESLLN KQWKFRS TI NVRLSCCVAGHIK+T+AG DI+ETMD L+EN LD  +EEY+FI+ +L+ G NC+RC EWCRLP++TPCRHLLCLDCV LDS+ CT+ GCG+LYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKV+YL++RL+ L E NK+   S ++ D     D    P   S+  +   L+    G++   +  +KVLIFSQFLEHIHVIEQQLT AGIKF  MYSPM S NKMK+LAMFQ D  CMALLMDGS ALGLDLSFVTHVFLMEPIWD+S+EEQVISRAHRMGA RPI VETL MRGTIEEQMM FL+DA+   + L  +   +  E +R  RTLHD  ESNYL+ LSFV  +
Sbjct:  957 NELVETVRRNILLADWNDPSHVESLLNSKQWKFRSITISNVRLSCCVAGHIKMTDAGHDIKETMDALLENDLDLWTEEYSFIQDSLIGGCNCKRCGEWCRLPVITPCRHLLCLDCVALDSERCTISGCGYLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVSYLVDRLRKLHEGNKKSILSFNKTDNDNLEDN---PPGTSEAFLGKELHGQDCGSQ--MVFVDKVLIFSQFLEHIHVIEQQLTTAGIKFGKMYSPMQSYNKMKALAMFQNDADCMALLMDGSGALGLDLSFVTHVFLMEPIWDKSLEEQVISRAHRMGAKRPIFVETLTMRGTIEEQMMRFLEDAEKSDRLLSGDYIEAKQETTRSRRTLHDLVESNYLSHLSFVRSD 1359          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_SCHPO (DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.547e-15
Identity = 42/121 (34.71%), Postives = 66/121 (54.55%), Query Frame = -2
Query:  527 PEKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAA-LGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEF 886
            PEKV+IFSQF   + +I   L    + +A     M    +  +L  F+ D     L++   A  +GL+L+   HVF+M+P W  S+E Q I R HR+G  +P+ V    +R T+EE+M++ 
Sbjct:  981 PEKVVIFSQFTTFLDIIADVLESEKMGYARFDGTMSQQMRSTALETFRNDPDVNVLIISLKAGGVGLNLTCANHVFIMDPWWSWSVEAQAIDRIHRLGQEKPVFVTRYIVRDTVEERMLKI 1101          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: YF2C_SCHPO (Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.882e-15
Identity = 41/133 (30.83%), Postives = 73/133 (54.89%), Query Frame = -2
Query:  488 EKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSA-ALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADACRKFLKE 883
            EK+L++SQF +++ ++   L    I+       M +  + KSL  F  D   + +L+   A ++GL+L+   HV L EP ++ S+E+Q I R HR+G  +P+ V     + TIEE+++   +     R+ +KE
Sbjct:  742 EKILVYSQFSQYLCLVSHMLKLENIRHVRYDGTMSANQRQKSLHSFNNDKDVLVMLVSLKAGSVGLNLTIANHVILQEPFYNPSIEDQAIDRVHRLGQQKPVTVYRFITKDTIEERIVSVQRKK---RQLVKE 871          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_CRYNB (DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.003e-15
Identity = 39/127 (30.71%), Postives = 72/127 (56.69%), Query Frame = -2
Query:  509 KVLIFSQFLEHIHVIEQQLTFAGIK---FAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADA 880
            K L+FSQF   + +IE  LT  GI+   F G  S     N ++     + ++  + L+   +  +GL+L+   +VFLM+  W+ ++E+Q I R HR+G  +P++V    ++GT+E+++M+  +   A
Sbjct: 1037 KALVFSQFTSFLDLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGR-KTNEPLILLISLKAGGVGLNLTMANYVFLMDTWWNEAIEQQAIDRVHRLGQNKPVYVTRYIIKGTVEKRIMKIQRSKTA 1162          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_CRYNJ (DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.637e-15
Identity = 39/127 (30.71%), Postives = 72/127 (56.69%), Query Frame = -2
Query:  509 KVLIFSQFLEHIHVIEQQLTFAGIK---FAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQDADA 880
            K L+FSQF   + +IE  LT  GI+   F G  S     N ++     + ++  + L+   +  +GL+L+   +VFLM+  W+ ++E+Q I R HR+G  +P++V    ++GT+E+++M+  +   A
Sbjct: 1037 KALVFSQFTSFLDLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGR-KTNEPLILLISLKAGGVGLNLTMANYVFLMDTWWNEAIEQQAIDRVHRLGQNKPVYVTRYIIKGTVEKRIMKIQRSKTA 1162          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: YG42_SCHPO (Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.607e-14
Identity = 39/123 (31.71%), Postives = 71/123 (57.72%), Query Frame = -2
Query:  518 EKVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAA-LGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEFLQD 883
            +K+LIFSQF+  + +        GIK+      + +  + ++L  F+ D +   LL+   A  +GL+L+   HV +++P W+  +EEQ + RAHR+G  +P+++  +    TIEE+++  LQD
Sbjct:  884 DKILIFSQFVSFLELFTVPFRQEGIKYLMYTGGLSTAERNQALINFEVDPNVRVLLISLKAGNVGLNLTCANHVIILDPFWNPYIEEQAVDRAHRIGQDKPVNILRIVTNNTIEERVLA-LQD 1005          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_DEBHA (DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.707e-14
Identity = 62/265 (23.40%), Postives = 117/265 (44.15%), Query Frame = -2
Query:  527 VTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSRLGNESCKMLPEKVLIFSQFLEHIHVIEQQLT------FAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAA-LGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEF 1300
            +TPC H  CL+CV             H ++ Q   +  +P  PN + P+ K                        K+  L  R  +++E+    +  M++  +      +L    ++   +  L+NH ++  E      E+V++FSQF  ++ +IE +L       F   KF G  +       +++ +  ++++  M LL+   A  +GL+L+  +  F+M+P W  S+E+Q I R HR+G    + V    M  +IE +M++ 
Sbjct:  931 LTPCGHAYCLNCV-----------LEH-FDFQEKNS-QKPLCPNCREPISK-----------------------YKIFKLRHRDTSVKEIRFHTKQEMEDPSQNFKFQLYLYDPTKTSSKIQCLINHLKILKEQSP--NEQVVVFSQFSSYLDIIENELKIQISNDFVVYKFDGRLNMNERQKILENFSSQKHENKVMILLLSLKAGGVGLNLTTASRAFMMDPWWSPSVEDQAIDRLHRIGQNSNVKVTRFIMADSIETKMLKI 1157          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_YEAST (DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.168e-13
Identity = 42/124 (33.87%), Postives = 70/124 (56.45%), Query Frame = -2
Query:  533 EKVLIFSQFLEHIHVIEQQLT------FAGI-KFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMDGSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMM 883
            E+V+IFSQF  ++ ++E++LT       A I KF G  S     + +   A+  Y    + LL   +  +GL+L+  +H ++M+P W  SME+Q I R HR+G T  + V    ++ +IEE+M+
Sbjct: 1013 EQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSIEEKML 1136          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: YBMA_SCHPO (Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.446e-13
Identity = 43/119 (36.13%), Postives = 65/119 (54.62%), Query Frame = -2
Query:  527 KVLIFSQFLEHIHVIEQQLTFAGIKFAGMYSPMHSGNKMKSLAMFQYDDSCMALLMD-GSAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEF 880
            K +IFSQF   + +I+  L  AGI F      M++  + KSL + + D     LL      ALGL+L+  + V L +  W+ ++EEQ I R HR+G  R + V  L +  TIEE+++E 
Sbjct:  672 KTIIFSQFTTFLDIIDLHLRKAGIGFVRYDGRMNNRAREKSLDLLRSDSGTQVLLCSLKCGALGLNLTCASRVILCDVWWNPAIEEQAIDRVHRIGQRRDVLVYKLVVENTIEEKIVEL 790          
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Match: RAD5_CANAL (DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.970e-13
Identity = 83/355 (23.38%), Postives = 144/355 (40.56%), Query Frame = -2
Query:  527 TTIRNVRLSCC----VAG------HIKVTEAGEDIQETMDILVENGLDPLSEEYAFIKYNLLYG-----GNCQRCNEWCRLP----IVTPCRHLLCLDCVGLDSKMCTLPGCGHLYEMQTPETLARPENPNPKWPVPKDLIELQPSYKQDDWNPDWQSTSSSKVAYLMERLKALQEVNKEVRCSMDEDDEAKHIDKFLCPSQRSDMGVPLLLNHSR-LGNESCKMLPEKVLIFSQFLEHIHVIEQQLTFAG-----IKFAGMYSPMHSGNKMKSLAMFQ--YDDSCMALLMDG--SAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPIHVETLAMRGTIEEQMMEF 1504
            T I  +R  CC    + G       I   E  ED+++ +  + EN +   ++     K   LYG       C  C +   +P    +VTPC H  CL C+             HL                          + Q   K++   P+ +S  S    Y + R++       E+R    +D        +L    RS   +  L+ H + L ++S      KV++FSQF  ++ +I+ +L  A       KF G    ++  ++ K L  F    +D  +A+L+    +  +GL+L+  +  ++M+P W  S+E+Q I R HR+G    + V    M  +IE +M++ 
Sbjct:  745 THILRLRQVCCHVDLIGGAHEMDDEIIEAEQDEDMRKFLTSIKENQIRFANDTDVKEKMYNLYGKIKEENECSICTQ-VPIPYSEMVVTPCAHTFCLSCI-----------LEHL--------------------------DFQKELKKEKLCPNCRSPISK---YQLFRIRNQPTKGNEIRFHTQKDAPDYSFQLYLYDPNRSSSKIQALVRHLKALHSQSPN---SKVIVFSQFSSYLDIIQSELKLASEEFIVFKFDGR---LNMNDRTKLLESFNQPLEDGKVAILLLSLKAGGVGLNLTTASRAYMMDPWWSPSIEDQAIDRIHRIGQNETVKVVRFIMENSIETKMLKI 1052          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PRQ1_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2VUD8_GOSRA0.000e+098.05Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FRB8_THECC0.000e+093.67SNF2 domain-containing protein / helicase domain-c... [more]
A0A061FS07_THECC0.000e+093.67SNF2 domain-containing protein / helicase domain-c... [more]
A0A0D2V0N4_GOSRA0.000e+093.19Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9RGB4_RICCO0.000e+080.39Putative uncharacterized protein OS=Ricinus commun... [more]
A5BGE7_VITVI0.000e+078.97Putative uncharacterized protein OS=Vitis vinifera... [more]
V4U415_9ROSI0.000e+078.73Uncharacterized protein OS=Citrus clementina GN=CI... [more]
M5XQS9_PRUPE0.000e+077.37Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A0A0D2RW69_GOSRA0.000e+098.15Uncharacterized protein OS=Gossypium raimondii GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010658 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
FB304_ARATH0.000e+069.85F-box protein At3g54460 OS=Arabidopsis thaliana GN... [more]
RAD5_SCHPO3.547e-1534.71DNA repair protein rad8 OS=Schizosaccharomyces pom... [more]
YF2C_SCHPO4.882e-1530.83Uncharacterized ATP-dependent helicase C17A2.12 OS... [more]
RAD5_CRYNB7.003e-1530.71DNA repair protein RAD5 OS=Cryptococcus neoformans... [more]
RAD5_CRYNJ7.637e-1530.71DNA repair protein RAD5 OS=Cryptococcus neoformans... [more]
YG42_SCHPO1.607e-1431.71Uncharacterized ATP-dependent helicase C23E6.02 OS... [more]
RAD5_DEBHA1.707e-1423.40DNA repair protein RAD5 OS=Debaryomyces hansenii (... [more]
RAD5_YEAST2.168e-1333.87DNA repair protein RAD5 OS=Saccharomyces cerevisia... [more]
YBMA_SCHPO2.446e-1336.13Uncharacterized ATP-dependent helicase C582.10c OS... [more]
RAD5_CANAL5.970e-1323.38DNA repair protein RAD5 OS=Candida albicans (strai... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 254..336
e-value: 2.0E-4
score: 30.7
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 239..336
e-value: 7.3E-9
score: 35.8
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 231..374
score: 9.772
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 241..363
e-value: 7.9E-11
score: 41.1
coord: 173..192
e-value: 7.9E-11
score: 41.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 241..362
coord: 168..192
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 205..220
e-value: 3.6E-5
score: 22.8
coord: 89..114
e-value: 3.6E-5
score: 22.8
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 1..26
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 90..128
coord: 238..358
NoneNo IPR availablePANTHERPTHR10799:SF573TRANSCRIPTION TERMINATION FACTOR 2coord: 1..26
coord: 165..189
NoneNo IPR availablePANTHERPTHR10799:SF573TRANSCRIPTION TERMINATION FACTOR 2coord: 90..128
NoneNo IPR availablePANTHERPTHR10799:SF573TRANSCRIPTION TERMINATION FACTOR 2coord: 238..358
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 165..189
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 105..114

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010658 ID=g.arboreum_cottongen_reftransV1_0010658|Name=g.arboreum_cottongen_reftransV1_0010658|organism=Gossypium arboreum|type=contig|length=1610bp
CTCAAATCCAACTCTAAAATATATTTCAATTAGAATTCACCTGTTTGGAA
GATAATGCAATGAATATTCATCCAGACATGTGACATAACATATCAGTAAA
GGCACCATTATACACCAAAAAATGACCTAAAACATACAACCTACAGATAA
TAAATGTTAAATTATCCTATGTATTAGGTACCAAAAAATTAGCAACACCA
AGGTATTTTCTACAACAATGAAAGATGGTTGTGAACTGTACCATGTTCCA
CCAAAAGGTACCGAGTATCAAGAACAAGCTGCACTATATTTGTAGAACCG
TCAACTGAAGTCGGTGCTAATATTTTAAAATGGTGCCCTCCTATCCTTTT
AGAATAACAGTCCTGTAAGTCACTTAGGATACTGAATTTCTATGCACAAA
GCTAAGTCGAGCCAAATAATTACTCTCAGCAAAATCATGGAGTGTTCGAC
AAGGTCGTGAACCCTCATGGCCTGATCTCTGGGACTCTTCTTTCAAAAAT
TTCCTACATGCATCAGCATCCTGTAAGAATTCCATCATTTGTTCTTCAAT
TGTACCACGCATGGCTAAAGTTTCCACATGAATTGGACGAGTAGCACCCA
TCCGATGGGCACGACTAATGACTTGTTCCTCCATGCTTCTGTCCCAAATA
GGCTCCATTAAAAATACATGAGTAACAAAACTTAAATCAAGACCCAATGC
AGCACTCCCATCCATCAAGAGAGCCATGCAGCTATCATCATACTGGAACA
TGGCCAGTGACTTCATCTTGTTGCCAGAATGCATTGGACTATACATTCCA
GCAAACTTGATACCAGCAAAAGTAAGCTGCTGCTCAATAACATGTATATG
CTCAAGAAATTGGGAAAATATTAGAACTTTCTCTGGAAGCATCTTGCATG
ACTCATTGCCCAGTCTAGAGTGATTCAGCAGCAAAGGCACGCCCATATCA
CTCCTCTGTGAAGGACAAAGAAACTTATCTATGTGCTTGGCTTCATCATC
TTCATCCATAGAGCAACGGACCTCTTTATTTACCTCCTGCAATGCCTTCA
GCCTCTCCATAAGATAAGCAACTTTACTGCTAGAGGTTGATTGCCAATCA
GGATTCCAGTCATCCTGTTTATATGAAGGTTGTAATTCGATAAGATCTTT
TGGGACAGGCCACTTGGGATTTGGATTTTCCGGGCGCGCTAATGTTTCAG
GAGTCTGCATCTCATATAAGTGACCACAGCCAGGTAAAGTACACATTTTA
CTGTCCAAACCAACACAATCAAGGCACAAAAGATGCCTACATGGGGTAAC
AATTGGTAGACGGCACCATTCATTGCATCTCTGACAATTACCACCATAAA
GGAGGTTATATTTAATAAAAGCATATTCTTCTGAAAGAGGATCCAGGCCA
TTTTCAACTAAAATGTCCATTGTTTCTTGAATATCTTCACCAGCTTCTGT
CACTTTTATATGCCCAGCCACACAACAAGACAACCTGACATTTCTAATTG
TTGTACTCCGAAACTTCCACTGCTTTGGATTTAATAAACTTTCAACATGA
GAAGGATCATTCCAGTCAGCCATTAGAATATTACGCCGCACTGTAACTAC
CAATTCATTA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS