g.arboreum_cottongen_reftransV1_0011991, g.arboreum_cottongen_reftransV1_0011991 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0011991
Unique Nameg.arboreum_cottongen_reftransV1_0011991
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1854
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr3chromosomeg.arboreum_cottongen_reftransV1_0011991:42..1854 .
Chr3:91493873..91495900 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A0D2TUK1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G239200 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 7.856e-165
Identity = 247/252 (98.02%), Postives = 251/252 (99.60%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYE+LQ+T+KSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKR+S
Sbjct: 1134 FCLRLYEYLQKTLKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLGYSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRDS 1385          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A0D2USZ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G239200 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 8.206e-165
Identity = 247/252 (98.02%), Postives = 251/252 (99.60%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYE+LQ+T+KSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKR+S
Sbjct: 1133 FCLRLYEYLQKTLKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLGYSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRDS 1384          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A061FFE4_THECC (P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_034949 PE=4 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.922e-142
Identity = 220/252 (87.30%), Postives = 237/252 (94.05%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYEHLQ+T+KSLG+PKITVGIITPYKLQLKCLQREFESV+++EEGK D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNA+ALVQSDDWAALIADAKAR CYMDMDSLPKDF K+LL   FSGPRGL Y PSQGK SNMRGLRSAGPRHRSLDMHM+SR+GTPSEDEDKSGT+VISRNGNYRPFK P++T LDDF  SGDKSREAWQYGI KKQ+SAG +GKR+S
Sbjct: 1102 FCLRLYEHLQKTVKSLGLPKITVGIITPYKLQLKCLQREFESVIKSEEGK-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNANALVQSDDWAALIADAKARKCYMDMDSLPKDFPKELL-SNFSGPRGLGYPPSQGKVSNMRGLRSAGPRHRSLDMHMDSRAGTPSEDEDKSGTSVISRNGNYRPFKPPMETSLDDFDQSGDKSREAWQYGIQKKQSSAGVVGKRDS 1351          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A061FG69_THECC (P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 3 OS=Theobroma cacao GN=TCM_034949 PE=4 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 3.925e-142
Identity = 220/252 (87.30%), Postives = 237/252 (94.05%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYEHLQ+T+KSLG+PKITVGIITPYKLQLKCLQREFESV+++EEGK D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNA+ALVQSDDWAALIADAKAR CYMDMDSLPKDF K+LL   FSGPRGL Y PSQGK SNMRGLRSAGPRHRSLDMHM+SR+GTPSEDEDKSGT+VISRNGNYRPFK P++T LDDF  SGDKSREAWQYGI KKQ+SAG +GKR+S
Sbjct: 1136 FCLRLYEHLQKTVKSLGLPKITVGIITPYKLQLKCLQREFESVIKSEEGK-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNANALVQSDDWAALIADAKARKCYMDMDSLPKDFPKELL-SNFSGPRGLGYPPSQGKVSNMRGLRSAGPRHRSLDMHMDSRAGTPSEDEDKSGTSVISRNGNYRPFKPPMETSLDDFDQSGDKSREAWQYGIQKKQSSAGVVGKRDS 1385          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A0D2TSW3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G282100 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 2.223e-125
Identity = 204/252 (80.95%), Postives = 222/252 (88.10%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESV+++EEG  D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRAL VMGNA ALVQSDDWAALIADAKARNCY+DMDSLPKDF KDL+ K+FSGPRGL Y PSQGKASN R  R AGPRHRS DMHM+SRSGTP ED  KS    I RNGNYRPFK P++  LD+F  +GDKSR+AWQYG  +K+NSAG + K++S
Sbjct: 1133 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVIKSEEGN-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALLVMGNAKALVQSDDWAALIADAKARNCYVDMDSLPKDFQKDLVSKDFSGPRGLGYPPSQGKASNTRSFRYAGPRHRSGDMHMDSRSGTPLEDAGKS----IYRNGNYRPFKPPMEPSLDNFDQAGDKSRDAWQYGT-QKRNSAGALWKKDS 1378          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A0B0MLJ7_GOSAR (SPBC29A10.10c: Uncharacterized ATP-dependent helicase C29A10.10c OS=Gossypium arboreum GN=F383_21170 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.384e-121
Identity = 203/260 (78.08%), Postives = 220/260 (84.62%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALW--------VMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL-YSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
            FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESV+++EEG  D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRAL         VMGNA ALVQSDDWAALIADAKARNCYMDMDSLPKDF KDL+ K+FSG RGL Y PSQGKASN R  R AGPRHRS DMHM+SRSGTP ED  KS    I RNGNYRPFK P++  LD+F  +GDKSR+AWQYG  +K+NSA  + K++S
Sbjct: 1145 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVIKSEEGN-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALLELTLMFEQVMGNAKALVQSDDWAALIADAKARNCYMDMDSLPKDFQKDLVSKDFSGSRGLGYPPSQGKASNTRSFRYAGPRHRSGDMHMDSRSGTPLEDAGKS----IYRNGNYRPFKPPMEPSLDNFDQAGDKSRDAWQYGT-QKRNSAAALWKKDS 1398          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: W9RSI0_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_021548 PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 2.434e-119
Identity = 193/251 (76.89%), Postives = 216/251 (86.06%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGKA-SNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRE 752
            FCLR+YEHLQ+T KSLG+ KI+VGIITPYKLQLKCLQREFE VL +EEGK D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNA+AL+QSDDWAALIADAK+R+CYMDMDSLPKDF   L+PK      G Y+P  GK  SN RGLRS GPRHRS DMHMESRSGT SED++KSG   ISRNG+YRPF+ P +  LDDF  SGD+S++AWQYGI KKQNS+G + KR+
Sbjct:  721 FCLRVYEHLQKTAKSLGLGKISVGIITPYKLQLKCLQREFEDVLNSEEGK-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNANALIQSDDWAALIADAKSRDCYMDMDSLPKDF---LVPK------GPYTPLPGKVLSNSRGLRSGGPRHRSFDMHMESRSGTLSEDDEKSGVA-ISRNGSYRPFRPPFENSLDDFDQSGDRSKDAWQYGIQKKQNSSGVVAKRD 960          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: M5XRW4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000264mg PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.229e-117
Identity = 190/251 (75.70%), Postives = 218/251 (86.85%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGK-ASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRE 752
            FC+RLYEHL +++K+ GV KI+VGIITPYKLQLKCLQREFE VL +EEGK D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNA+AL+QSDDWA+LI DAKARNCYMDM++LPK+F   L+PK   GP   Y+P  GK +SNMRG RSAGPRHRSLDMH+ESRSGTPSED++K G +VISRNG YRP K P +  LDDF  SGDKSR+AWQYGI +K +SAG +G+R+
Sbjct: 1134 FCVRLYEHLHKSLKAFGVGKISVGIITPYKLQLKCLQREFEDVLNSEEGK-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNANALMQSDDWASLITDAKARNCYMDMETLPKEF---LVPK---GPS--YTPLPGKPSSNMRGFRSAGPRHRSLDMHVESRSGTPSEDDEKLGASVISRNGTYRPMKPPFENSLDDFDQSGDKSRDAWQYGIQRKHSSAGVVGRRD 1375          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A5BNC8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_009619 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.872e-117
Identity = 192/252 (76.19%), Postives = 220/252 (87.30%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGK-ASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES 755
             CLRLYEHLQ+T+KSLG+ KI+VGIITPYKLQLKCLQREF+ VL +EEGK D+YINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNA+AL+QSDDWAALI+DA+AR+CY+DMDSLPK+F   L+PK   GP   Y P  GK +SNMRGLRSAGPRHR LDMH+ES+SGTPSED++KS  ++ISRNGNYRP K  ++  LDDF  S DKSR+AWQYGI KKQ+SAG + KR+S
Sbjct: 1166 ICLRLYEHLQKTLKSLGMGKISVGIITPYKLQLKCLQREFDDVLSSEEGK-DLYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNANALMQSDDWAALISDARARSCYLDMDSLPKEF---LVPK---GP--TYGPLSGKVSSNMRGLRSAGPRHRQLDMHVESKSGTPSEDDEKSNASLISRNGNYRPLKPTMENSLDDFDQSADKSRDAWQYGIQKKQSSAGVVAKRDS 1408          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Match: A0A067EWL0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g047960mg PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 5.482e-115
Identity = 185/267 (69.29%), Postives = 211/267 (79.03%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGK-ASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGTTVISRNGNYRPFKSPLDTFLDDFHPSGDKSREAWQYGILKKQNSAGTMGKRES*ALVVVYELFWLMAV 800
            F + LYEHLQ+T+KS+G+ K+TVGIITPYKLQLKCLQ EF +VL +EEGK D+YINTVDAFQGQERDVIIMSCVRAS+HGVGFVADIRRMNVALTRARRALWVMGNA AL QSDDWAALIAD+KARNCYMDMDSLPK+F+  L  K        Y P QGK   N RGLRSAG RHRS DM+MESRSGTPSED++K     +SRNGNYRPFK PL+  LDDF  SG+K R+AWQ+GI KKQ+S G    R    L  + + FW + +
Sbjct:   76 FGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGK-DLYINTVDAFQGQERDVIIMSCVRASNHGVGFVADIRRMNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMDSLPKEFSVALAAKAPG-----YGPLQGKIPHNARGLRSAGQRHRSFDMNMESRSGTPSEDDEK-----VSRNGNYRPFKPPLENSLDDFDQSGEKYRDAWQHGIQKKQSSGGKGSPR----LEDLVDAFWWVGL 327          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: YGSA_SCHPO (Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.345e-24
Identity = 67/175 (38.29%), Postives = 105/175 (60.00%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCL----QREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRAS-SHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGKASNMRGLRS 512
            F L LYE L +   ++      +G++TPY+ Q++ L    QR++ S++      + + I+TVD FQGQE+D+II SCVR+S S G+GF+ D+RR+NVALTRA+ +L+++GN+  L+Q D + +LI DAK R  +           +DL   +F   + + + S   ASN   L S
Sbjct: 1650 FILLLYERLIQCYLNIDFEG-KIGVVTPYRSQVQQLRSQFQRKYGSIIF-----KHLDIHTVDGFQGQEKDIIIFSCVRSSMSGGIGFLQDLRRLNVALTRAKSSLYIVGNSKPLMQEDIFYSLIEDAKTRGVW-----------RDLSANQFKNSKSISNVSTHLASNNLNLAS 1807          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: SEN1_YEAST (Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 1.569e-22
Identity = 51/108 (47.22%), Postives = 75/108 (69.44%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRA--SSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNC 386
            +GII+PY+ Q++ +++EF         K  I  NT+D FQGQE+++I++SCVRA  +   VGF+ D RRMNVALTRA+ ++WV+G+  +L +S  W  LI DAK R+C
Sbjct: 1746 IGIISPYREQMQKMRKEFARYFGGMINK-SIDFNTIDGFQGQEKEIILISCVRADDTKSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIEDAKDRSC 1852          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: SEN1_SCHPO (Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.686e-21
Identity = 53/108 (49.07%), Postives = 72/108 (66.67%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQREFESVLRTEEGKR---DIYINTVDAFQGQERDVIIMSCVRA-SSHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKAR 380
            +G+ITPY+ QL  L+R F    + + GK     I I TVD FQGQE+D+I  SCV++ S HG+GF+ D RR+NVALTRAR +L ++GN   L   D W +L+ DA +R
Sbjct: 1533 IGVITPYRSQLHELRRAF----KVKYGKSFMSTIDIQTVDGFQGQEKDIIFFSCVKSYSKHGIGFLRDFRRLNVALTRARSSLLIIGNMETLKTDDLWGSLVDDALSR 1636          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: MAA3_ARATH (Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.848e-19
Identity = 52/128 (40.62%), Postives = 78/128 (60.94%), Query Frame = 3
Query:    3 FCLRLYEHLQRTIKSLGVPKITVGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSHG-VGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARN 383
            F L +Y  L      L      + II+PY  Q+K  +  F+ +  TE  ++ + INTVD FQG+E+DV I SCVRA+ +G +GF+++ RRMNV +TRA+ ++ V+G+A+ L     W  LI  A+ RN
Sbjct:  626 FVLLIYHRLVTMYPELKSSS-QLAIISPYNYQVKTFKDRFKEMFGTE-AEKVVDINTVDGFQGREKDVAIFSCVRANENGQIGFLSNSRRMNVGITRAKSSVLVVGSAATLKSDPLWKNLIESAEQRN 751          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: Y4399_DICDI (Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.934e-19
Identity = 48/101 (47.52%), Postives = 67/101 (66.34%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQREFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSH---GVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALI 362
            +GII+PY+ Q+  L+  F++          I I+TVD FQG+ER++II SCVRA      G+GF++D+RRMNVALTR R +L ++GN  AL  + DW  LI
Sbjct:  744 IGIISPYRQQVLALREIFKNY-------PGISIDTVDGFQGREREIIIFSCVRAPVEEGAGIGFLSDVRRMNVALTRPRSSLLILGNTKALSINKDWNELI 837          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: RENT1_NEUCR (Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.631e-19
Identity = 57/163 (34.97%), Postives = 91/163 (55.83%), Query Frame = 3
Query:   51 GVPKITVGIITPYKLQLKCLQREFESV-LRTEEGKRDIYINTVDAFQGQERDVIIMSCVRAS-SHGVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSP----SQGKASNMRGLRSAGP 521
            GV    +G+ITPY+ Q   +    ++     +E  R++ + +VDAFQG+E+D I++SCVR++ + G+GF++D RR+NVALTRA+  L ++GN   L + + W  L+   K + C   ++    +    LL  +F  PR  Y P    +Q  AS     R A P
Sbjct:  769 GVKPADIGVITPYEGQRSYIVNTMQNTGTFKKESYREVEVASVDAFQGREKDFIVLSCVRSNENQGIGFLSDPRRLNVALTRAKYGLVIIGNPKVLCKHELWHHLLVHFKDKKCL--VEGPLTNLQPSLL--QFGRPRQAYRPQRSHTQHVASGPSNGRFAAP 927          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: RENT1_MOUSE (Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 7.161e-18
Identity = 56/135 (41.48%), Postives = 85/135 (62.96%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQR--EFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSH-GVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGL 464
            +GIITPY+ Q   L +  +F   L T+   +++ I +VDAFQG+E+D II+SCVRA+ H G+GF+ D RR+NVALTRAR  + ++GN  AL +   W  L++  K +   ++    P +  ++ L  +FS PR L
Sbjct:  796 IGIITPYEGQRSYLVQYMQFSGSLHTKL-YQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVEG---PLNNLRESL-MQFSKPRKL 925          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: RENT1_TAKRU (Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.650e-18
Identity = 63/179 (35.20%), Postives = 96/179 (53.63%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQR--EFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSH-GVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMDMDSLPKDFTKDLLPKEFSGPRGLYSPSQGKASNMRGLRSAGPRHRSLDMHMESRSGTPSEDEDKSGT 596
            +GIITPY+ Q   L +  +F   L T+     + I +VDAFQG+E+D II+SCVRA+ H G+GF+ D RR+NVALTRA+  + ++GN  AL +   W  L+ + K +   ++    P +  ++ L  +FS PR L             + +  PR  S  M+    +  P    D+S T
Sbjct:  771 IGIITPYEGQRSYLVQYMQFSGSLHTK--LYQVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQPLWNNLLNNYKEQKVLVEG---PLNNLRESL-MQFSKPRKL-------------VNTINPRFMSTAMYDAREALIPGSAYDRSNT 930          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: RENT1_DICDI (Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.690e-18
Identity = 54/145 (37.24%), Postives = 84/145 (57.93%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQREFESVLRTE-EGKRDIYINTVDAFQGQERDVIIMSCVRASSH-GVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMD--MDSLPKDFTKDLLPKEFSGPRGLYSPSQGKAS 491
            +GIITPY+ Q   +    +   +   E  + I + +VD+FQG+E+D II+SCVR++ + G+GF+ D RR+NVALTRAR  L ++GNA  L +   W +LI+  K +N  ++  + +L +       PK+  G   L  P Q   S
Sbjct:  859 IGIITPYEGQRAYITSHMQKSGKLNLELYKSIEVASVDSFQGREKDYIILSCVRSNDYQGIGFLQDPRRLNVALTRARFGLIILGNAKVLSKDPLWNSLISHFKNKNVLVEGSLANLKQSPVILQKPKKLYGQGKLPIPGQNSNS 1003          
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Match: RENT1_HUMAN (Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.068e-17
Identity = 66/187 (35.29%), Postives = 100/187 (53.48%), Query Frame = 3
Query:   69 VGIITPYKLQLKCLQR--EFESVLRTEEGKRDIYINTVDAFQGQERDVIIMSCVRASSH-GVGFVADIRRMNVALTRARRALWVMGNASALVQSDDWAALIADAKARNCYMD--MDSL---------PKDFTKDLLP------------KEFSGPRGLYS-PSQGKASNMR-------GLRSAGPRH 527
            +GIITPY+ Q   L +  +F   L T+   +++ I +VDAFQG+E+D II+SCVRA+ H G+GF+ D RR+NVALTRAR  + ++GN  AL +   W  L+   K +   ++  +++L         P+     + P            +E   P  +Y   SQG+ S+M        G+ SAGP H
Sbjct:  801 IGIITPYEGQRSYLVQYMQFSGSLHTKL-YQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSH 986          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TUK1_GOSRA7.856e-16598.02Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2USZ4_GOSRA8.206e-16598.02Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FFE4_THECC1.922e-14287.30P-loop containing nucleoside triphosphate hydrolas... [more]
A0A061FG69_THECC3.925e-14287.30P-loop containing nucleoside triphosphate hydrolas... [more]
A0A0D2TSW3_GOSRA2.223e-12580.95Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MLJ7_GOSAR1.384e-12178.08SPBC29A10.10c: Uncharacterized ATP-dependent helic... [more]
W9RSI0_9ROSA2.434e-11976.89Uncharacterized protein OS=Morus notabilis GN=L484... [more]
M5XRW4_PRUPE1.229e-11775.70Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A5BNC8_VITVI1.872e-11776.19Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A067EWL0_CITSI5.482e-11569.29Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0011991 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
YGSA_SCHPO1.345e-2438.29Uncharacterized ATP-dependent helicase C29A10.10c ... [more]
SEN1_YEAST1.569e-2247.22Helicase SEN1 OS=Saccharomyces cerevisiae (strain ... [more]
SEN1_SCHPO1.686e-2149.07Helicase sen1 OS=Schizosaccharomyces pombe (strain... [more]
MAA3_ARATH1.848e-1940.63Probable helicase MAGATAMA 3 OS=Arabidopsis thalia... [more]
Y4399_DICDI6.934e-1947.52Probable helicase DDB_G0274399 OS=Dictyostelium di... [more]
RENT1_NEUCR7.631e-1934.97Regulator of nonsense transcripts 1 homolog OS=Neu... [more]
RENT1_MOUSE7.161e-1841.48Regulator of nonsense transcripts 1 OS=Mus musculu... [more]
RENT1_TAKRU7.650e-1835.20Putative regulator of nonsense transcripts 1 OS=Ta... [more]
RENT1_DICDI7.690e-1837.24Regulator of nonsense transcripts 1 OS=Dictyosteli... [more]
RENT1_HUMAN1.068e-1735.29Regulator of nonsense transcripts 1 OS=Homo sapien... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13087AAA_12coord: 6..105
e-value: 2.8E-32
score: 111.8
NoneNo IPR availablePANTHERPTHR10887:SF359HELICASE SEN1coord: 1..249
NoneNo IPR availablePANTHERPTHR10887DNA2/NAM7 HELICASE FAMILYcoord: 1..249
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 44..108
e-value: 5.3E-6
score: 25.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..134

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0011991 ID=g.arboreum_cottongen_reftransV1_0011991|Name=g.arboreum_cottongen_reftransV1_0011991|organism=Gossypium arboreum|type=contig|length=1854bp
TATTTTGTTTGCGCTTATATGAGCATCTACAGAGAACTATAAAATCTTTG
GGTGTGCCAAAAATCACAGTTGGTATAATAACACCATACAAGCTGCAATT
AAAATGCCTACAACGTGAGTTTGAGAGTGTTCTAAGGACAGAGGAAGGGA
AGAGGGATATCTATATTAATACTGTAGATGCTTTCCAGGGCCAGGAGCGT
GATGTTATTATTATGTCTTGTGTCCGTGCCTCAAGTCATGGGGTGGGCTT
TGTTGCAGATATTCGACGAATGAATGTTGCTCTTACTCGTGCTAGAAGGG
CTTTGTGGGTTATGGGTAATGCCAGTGCTCTGGTGCAATCAGATGACTGG
GCAGCCTTAATTGCTGATGCCAAAGCTAGGAATTGTTATATGGACATGGA
TTCTCTCCCCAAGGACTTCACAAAAGACTTGCTCCCCAAAGAATTTTCAG
GGCCAAGGGGACTTTACTCTCCATCACAGGGTAAGGCTTCTAATATGAGA
GGTTTAAGGTCTGCTGGACCAAGACATAGATCACTTGATATGCACATGGA
ATCCAGGTCAGGAACACCATCAGAGGATGAAGATAAGTCAGGCACAACTG
TAATTTCTAGGAATGGGAATTATCGGCCATTTAAGTCGCCACTGGATACT
TTTTTGGATGATTTTCATCCGTCAGGTGACAAATCTAGAGAGGCCTGGCA
ATATGGTATACTGAAGAAGCAAAATTCTGCTGGTACAATGGGGAAAAGAG
AGTCCTAGGCATTGGTTGTTGTCTACGAACTGTTTTGGCTCATGGCGGTC
CGTGGAGCAGAACTTTATTTATAATCCTTGCATTGAAATTTATGGAGCTC
TTAGCTCCATGAGTATTGAAACAATTTGTTGGAAGTTGGTGCCAGACTTG
TGTCTGATAATTGCCCTAAGATGAACAAGTTGAGAGGGATTTGCATGGGT
CACCAGTGAACTTTTGCCAGTCTGCCATGTTGATTCCTGCTAGGAAGTGG
ATGATCTGGGGGGTAGGATGTATGAGATCAAACCCTAGATCCACCCAGAC
AGGCTTCGAAGGAGTTGAATGCTGGCATTAAGAGTTGTGCCGCCCTACAA
TATCCCTTTGCTTGATAATTGATTGTTGCAATCTGCTATTACTTGGATGA
AGTCTTTAATCGATACAGTTGGGCAGTCATTTCAAATTCTGGTGCTCTTT
GACTTTTGTCCTTTTCCACAATACACTGAATGCATGGCCGACTCTTCAGT
TTGGGGATGTGAATTCTTTTGGATCTGTCAAATTTGAAGTTACATTCATC
AAATTTACAAATGCTTGCAAAATGTCAGAGGACGAGTAGCGATTCTTGAG
CGGGTGTGCTTTGCAGAATCCTAAGAATCAACCTCTATCAAAGTTGCCGT
ATATATTCTTTGAACATGGAGATGCACTTCGGTGATAACTTTTTAGTTCT
GCAGGATACGGGTTGGTTAACCAAGTATTCTTTGCTTTTGTTCTTTATGT
TAATTTTCCTTGGTTCTTTAAACCAAAAGACTTGGATAGAAATAGGACAC
ACCTCCAAAATTCTGTATAGAGAAGTAAGACTCCTAAAAGGGTACAGAAT
TGTGCGAGGAACTCTCATCTAGCTGACTTTGTGTATACAGCTTCAGGTGG
AACCAAAGAATTCTTTCTCAGCTGCGAAAAACCTCAGCTGCTGTTTTTTT
TTTTTTTTAAACTTGAAAACCATCAAATAATGGCCCAAGGTTTTAAACTA
TACTATTTGTTTTATTTTCCTATAATGAGATGTACTTTTCCTCAGATTGC
CATTACTTAAAAGTAATGCGGGGGATACAATTTATGTAGCGATGAACATA
TCCG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase