g.arboreum_cottongen_reftransV1_0013393, g.arboreum_cottongen_reftransV1_0013393 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0013393
Unique Nameg.arboreum_cottongen_reftransV1_0013393
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length531
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0013393:1..531 .
Chr11:35214353..35214883 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: A0A0D2S891_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G228300 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.079e-55
Identity = 149/160 (93.12%), Postives = 150/160 (93.75%), Query Frame = -2
Query:    3 MTTHSLASLHHQYSFLKRXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 476
            MTTHSLASLHHQYSFLKRLSNSESI LPPSSL     P  SSSSSSTT TTSSTTTTFSLSPTTSSSTPTT+NPISFD LKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK
Sbjct:    1 MTTHSLASLHHQYSFLKRLSNSESIHLPPSSLFLHPSPSSSSSSSSTTTTTSSTTTTFSLSPTTSSSTPTTTNPISFDNLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 160          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: A0A061EJ50_THECC (Enzyme binding,tetrapyrrole binding OS=Theobroma cacao GN=TCM_020047 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.326e-41
Identity = 72/83 (86.75%), Postives = 78/83 (93.98%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 251
            D L+HHLSTQNF QADEETRRLLIVLAGEAA+KR YVFFSEVQFISEADL AID+LWKQYS+N+FGYSVQKRLWQK +KDFTK
Sbjct:   72 DALQHHLSTQNFRQADEETRRLLIVLAGEAAEKRGYVFFSEVQFISEADLIAIDDLWKQYSSNRFGYSVQKRLWQKVDKDFTK 154          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: B9T5C4_RICCO (Tetrapyrrole-binding protein, chloroplast, putative OS=Ricinus communis GN=RCOM_0655990 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.764e-40
Identity = 72/84 (85.71%), Postives = 76/84 (90.48%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLW-QKANKDFTK 251
            D L+ HLS QNF QADEETRRLLIVLAGEA QKR YVFFSEVQFISE DLKAIDELWK+YSNNKFGYS+QKR+W QKANKDFTK
Sbjct:   78 DLLQQHLSAQNFRQADEETRRLLIVLAGEATQKRGYVFFSEVQFISENDLKAIDELWKKYSNNKFGYSIQKRIWQQKANKDFTK 161          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: A0A0D2VM76_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G142800 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.436e-39
Identity = 70/83 (84.34%), Postives = 76/83 (91.57%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 251
            DTL+HHLS QNF QADEETRRLLI+LAGEAAQKR YVFFSEVQFIS+ DLKAIDELWK++S+NKFGYSVQKR WQK  KDFTK
Sbjct:   79 DTLQHHLSNQNFRQADEETRRLLILLAGEAAQKRGYVFFSEVQFISQNDLKAIDELWKKHSDNKFGYSVQKRQWQKVKKDFTK 161          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: A0A067L5U3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_20841 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.774e-39
Identity = 69/84 (82.14%), Postives = 79/84 (94.05%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLW-QKANKDFTK 251
            D L+HHLSTQNF QADEETRRLLI+LAGEAAQKR YVFFSEVQFISE DLKAIDELWK+YS+NKFGYS+QK++W +KA+KDF+K
Sbjct:   79 DLLQHHLSTQNFRQADEETRRLLIILAGEAAQKRGYVFFSEVQFISEEDLKAIDELWKKYSDNKFGYSIQKQIWLKKADKDFSK 162          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: V4U2B7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10021505mg PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.271e-38
Identity = 67/83 (80.72%), Postives = 74/83 (89.16%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 251
            D L  HL  QNF QADEETRRLLI LAGEAA+KR YVFFSEVQFI+EADLKAIDELW+QYS+NKFGYSVQK++W+K NKDFTK
Sbjct:   99 DLLHQHLQAQNFRQADEETRRLLIALAGEAAEKRGYVFFSEVQFIAEADLKAIDELWRQYSDNKFGYSVQKKIWEKVNKDFTK 181          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: B9HH58_POPTR (Tetrapyrrole-binding family protein OS=Populus trichocarpa GN=POPTR_0007s02000g PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 4.602e-38
Identity = 69/82 (84.15%), Postives = 73/82 (89.02%), Query Frame = -2
Query:    3 LKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLW-QKANKDFTK 245
            L+ HLS QNF +ADEETRRLLIVLAGEAAQKR YVFFSEVQFI E DLK IDELWK+YSNNKFGYSVQKR+W QK NKDFTK
Sbjct:   78 LQQHLSNQNFREADEETRRLLIVLAGEAAQKRGYVFFSEVQFIPEQDLKDIDELWKKYSNNKFGYSVQKRIWRQKGNKDFTK 159          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: A5BEZ5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0102g00310 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 4.618e-38
Identity = 65/83 (78.31%), Postives = 76/83 (91.57%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 251
            D L+ HLS++N+ QADEETRRLLIVLAGEAA KR YVFFSEVQFI EADLKAIDELW+Q+SNNKFGYSVQ+R+W+K NKDF++
Sbjct:   83 DVLQQHLSSKNYRQADEETRRLLIVLAGEAAVKRGYVFFSEVQFIPEADLKAIDELWRQHSNNKFGYSVQRRIWEKVNKDFSR 165          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: U7DWM1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_2108s00210g PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.326e-38
Identity = 70/84 (83.33%), Postives = 74/84 (88.10%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQ-KANKDFTK 251
            D L+ HLS QNF +ADEETRRLLIVLAGEAAQ R YVFFSEVQFISE DLK IDELWK +SNNKFGYSVQKR+WQ KANKDFTK
Sbjct:   79 DLLQQHLSNQNFREADEETRRLLIVLAGEAAQTRGYVFFSEVQFISEEDLKDIDELWKNHSNNKFGYSVQKRIWQLKANKDFTK 162          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Match: U5FKC2_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0017s05900g PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.775e-38
Identity = 70/84 (83.33%), Postives = 74/84 (88.10%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQ-KANKDFTK 251
            D L+ HLS QNF +ADEETRRLLIVLAGEAAQ R YVFFSEVQFISE DLK IDELWK +SNNKFGYSVQKR+WQ KANKDFTK
Sbjct:   77 DLLQQHLSNQNFREADEETRRLLIVLAGEAAQTRGYVFFSEVQFISEEDLKDIDELWKNHSNNKFGYSVQKRIWQLKANKDFTK 160          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Match: GUN4C_ARATH (Tetrapyrrole-binding protein, chloroplastic OS=Arabidopsis thaliana GN=GUN4 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.353e-29
Identity = 53/83 (63.86%), Postives = 67/83 (80.72%), Query Frame = -2
Query:    3 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 251
            D L++HL  QNF QADEETRRLLI ++GEAA KR YVFFSEV+ IS  DL+AID LW ++S+ +FGYSVQ+++W K  KDFT+
Sbjct:   82 DVLENHLVNQNFRQADEETRRLLIQISGEAAVKRGYVFFSEVKTISPEDLQAIDNLWIKHSDGRFGYSVQRKIWLKVKKDFTR 164          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Match: YC53L_SYNY3 (Ycf53-like protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0558 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.511e-16
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = -2
Query:    3 LKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 245
            L+  L +Q+F  ADE TR  L  LAG  A +R++++F+EV+     DL  I+ LW  +SN  FG+SVQ+RLW  + K+FTK
Sbjct:   96 LQEALGSQDFETADEITRDKLCELAGPGASQRQWLYFTEVEKFPALDLHTINALWWLHSNGNFGFSVQRRLWLASGKEFTK 176          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Match: YCF53_CYACA (Uncharacterized protein ycf53 OS=Cyanidium caldarium GN=ycf53 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.110e-13
Identity = 29/74 (39.19%), Postives = 54/74 (72.97%), Query Frame = -2
Query:   30 DTLKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLW 251
            +TL+  LS  NFF+A++ T+++L+ LAGE +++R +++F++V  I+   +  ++ LW+ YS   FG+S+QKR+W
Sbjct:  103 ETLESLLSANNFFEANKFTQQILLELAGEQSKQRNWMYFTDVHSINHQSVSDLNHLWELYSQGNFGFSIQKRIW 176          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Match: YCF53_PYRYE (Uncharacterized protein ycf53 OS=Pyropia yezoensis GN=ycf53 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.658e-12
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = -2
Query:    3 LKHHLSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDFTK 245
            L+  L+ ++  +AD+ T++ LI LAG  AQ R +++F++++ I   DL+ ID+LW  +S  KFG  VQ+++W    KD+ K
Sbjct:  102 LQMLLTHRDLLKADQLTQQKLIQLAGVNAQTRNWLYFTDIKKIPAQDLQTIDKLWHTHSKGKFGLFVQRQIWLSVGKDWGK 182          
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Match: YCF53_PORPU (Uncharacterized protein ycf53 OS=Porphyra purpurea GN=ycf53 PE=3 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.110e-9
Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = -2
Query:    9 LSTQNFFQADEETRRLLIVLAGEAAQKRRYVFFSEVQFISEADLKAIDELWKQYSNNKFGYSVQKRLWQKANKDF 233
            L   N   AD+ T++ LI LAG   + R +++F++++ I   DL+ ID+LW  +S  KFG+ VQ+++W    K++
Sbjct:  107 LVQNNLIAADKLTQQKLIKLAGVDEKSRNWLYFTDIKKIPVEDLQTIDQLWNAHSKGKFGFFVQRQIWLALEKNW 181          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2S891_GOSRA2.079e-5593.13Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EJ50_THECC2.326e-4186.75Enzyme binding,tetrapyrrole binding OS=Theobroma c... [more]
B9T5C4_RICCO9.764e-4085.71Tetrapyrrole-binding protein, chloroplast, putativ... [more]
A0A0D2VM76_GOSRA2.436e-3984.34Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067L5U3_JATCU8.774e-3982.14Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
V4U2B7_9ROSI3.271e-3880.72Uncharacterized protein OS=Citrus clementina GN=CI... [more]
B9HH58_POPTR4.602e-3884.15Tetrapyrrole-binding family protein OS=Populus tri... [more]
A5BEZ5_VITVI4.618e-3878.31Putative uncharacterized protein OS=Vitis vinifera... [more]
U7DWM1_POPTR5.326e-3883.33Uncharacterized protein OS=Populus trichocarpa GN=... [more]
U5FKC2_POPTR5.775e-3883.33Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0013393 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
GUN4C_ARATH2.353e-2963.86Tetrapyrrole-binding protein, chloroplastic OS=Ara... [more]
YC53L_SYNY33.511e-1645.68Ycf53-like protein OS=Synechocystis sp. (strain PC... [more]
YCF53_CYACA1.110e-1339.19Uncharacterized protein ycf53 OS=Cyanidium caldari... [more]
YCF53_PYRYE4.658e-1238.27Uncharacterized protein ycf53 OS=Pyropia yezoensis... [more]
YCF53_PORPU1.110e-936.00Uncharacterized protein ycf53 OS=Porphyra purpurea... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008629GUN4-likePFAMPF05419GUN4coord: 70..158
e-value: 4.1E-31
score: 107.8
NoneNo IPR availablePANTHERPTHR34800FAMILY NOT NAMEDcoord: 1..158
NoneNo IPR availablePANTHERPTHR34800:SF1TETRAPYRROLE-BINDING PROTEIN, CHLOROPLASTICcoord: 1..158
NoneNo IPR availableSUPERFAMILY140869GUN4-likecoord: 71..157

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0013393 ID=g.arboreum_cottongen_reftransV1_0013393|Name=g.arboreum_cottongen_reftransV1_0013393|organism=Gossypium arboreum|type=contig|length=531bp
AATTTGGTGAAGTCCTTGTTGGCTTTTTGCCACAACCTTTTCTGCACACT
GTAACCGAACTTGTTGTTGCTGTACTGTTTCCAGAGCTCGTCAATAGCTT
TGAGGTCAGCTTCGGAGATGAACTGGACCTCGGAGAAGAAGACATATCGG
CGTTTCTGAGCTGCTTCACCGGCTAGAACTATGAGCAAGCGGCGTGTCTC
TTCGTCGGCTTGGAAGAAGTTCTGAGTGGAAAGGTGGTGTTTGAGGGTGT
CAAAAGAGATAGGGTTGGAAGTGGTGGGGGTGGAGGAGGAAGTTGTAGGA
GAAAGAGAGAAAGTGGTGGTTGTGGAAGAGGTTGTGTTGGTAGTGGAGGA
GGAGGAAGAGGAGGGGTAGGGGTGGAGGAAAAGGGAGGAAGGTGGAAGGG
GGATGGATTCTGAGTTGGAGAGGCGTTTGAGGAAAGAGTATTGGTGGTGA
AGGGATGCTAGAGAGTGGGTGGTCATGGTTTGGGTTTGTGGTGGGAATAG
TGTGACAATTGGGAATGGTAAAGAGAGAAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR008629GUN4-like