g.arboreum_cottongen_reftransV1_0021466, g.arboreum_cottongen_reftransV1_0021466 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0021466
Unique Nameg.arboreum_cottongen_reftransV1_0021466
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length960
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0021466:1..960 .
Chr11:80974326..80977436 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0B0Q234_GOSAR (Dna-directed rna polymerases i, ii, and iii subunit rpabc1 OS=Gossypium arboreum GN=F383_16361 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 6.202e-163
Identity = 228/228 (100.00%), Postives = 228/228 (100.00%), Query Frame = -2
Query:  192 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 228          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0D2NJ30_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1333002 PE=4 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 2.412e-161
Identity = 226/228 (99.12%), Postives = 227/228 (99.56%), Query Frame = -2
Query:  192 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRY+LSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKR LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYYLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRTLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 228          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0D2RU93_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1333002 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.196e-159
Identity = 226/229 (98.69%), Postives = 227/229 (99.13%), Query Frame = -2
Query:  192 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRM-LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRY+LSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKR  LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYYLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRQTLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 229          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A061EW60_THECC (Eukaryotic rpb5 RNA polymerase subunit family protein isoform 1 OS=Theobroma cacao GN=TCM_024387 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.492e-145
Identity = 201/228 (88.16%), Postives = 220/228 (96.49%), Query Frame = -2
Query:  192 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 875
            MEG GLEGDGSNGEALGKCLSG+VDDGSTESHRY+LSRRTVLEMLRDRGYAVP +EI+LSL EFRAI+GQSPDFDRL+LS THKTD SKR+LVVFYGPG+VKVSGIRLIAGLIT+KE+LTGLIL++QNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKP+H+VLTE EKQ+LLQKYSIEEKQLPRLLKKDAIARYYG+E+GQV+KV Y GEIT+SHVTYRCVW
Sbjct:    1 MEGNGLEGDGSNGEALGKCLSGVVDDGSTESHRYYLSRRTVLEMLRDRGYAVPISEINLSLQEFRAIYGQSPDFDRLRLSATHKTDPSKRILVVFYGPGMVKVSGIRLIAGLITNKESLTGLILVLQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPKHQVLTEQEKQKLLQKYSIEEKQLPRLLKKDAIARYYGYERGQVVKVMYDGEITQSHVTYRCVW 228          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0D2SP67_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1333002 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 6.827e-130
Identity = 190/204 (93.14%), Postives = 192/204 (94.12%), Query Frame = -2
Query:  264 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFE 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRY+LSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKR LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQ   L    A+  YY  E
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYYLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRTLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQAAILTVGRALVEYYSCE 204          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0D2RMD1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1333002 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 4.793e-128
Identity = 185/187 (98.93%), Postives = 186/187 (99.47%), Query Frame = -2
Query:  315 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQ 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRY+LSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKR LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQ
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYYLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRTLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQ 187          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A0D2Q0F3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G1333002 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.200e-127
Identity = 185/188 (98.40%), Postives = 187/188 (99.47%), Query Frame = -2
Query:  312 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQL 875
            MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRY+LSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKR LVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQ+
Sbjct:    1 MEGIGLEGDGSNGEALGKCLSGLVDDGSTESHRYYLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRTLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQV 188          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: B9ST46_RICCO (DNA-directed RNA polymerase II, putative OS=Ricinus communis GN=RCOM_0248850 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.510e-119
Identity = 165/217 (76.04%), Postives = 191/217 (88.02%), Query Frame = -2
Query:  192 NGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 842
            N E LGKC S   DDG+ E+HRY+LSRRTVLEMLRDRGY+VP++EIDLSL EFRAIHG +PD DRLK S TH +D SKRMLV+F GPG++KVS IR IAG I +K++LTGLIL++QN ITNQA+KA+DLF FKVE+FQITDLLVNITKHVLKP+H+VLT+ EKQ+LL+ Y IEEKQLPRLL+KDAIARYYG EKGQV+KVTY GEITESHVTYRCVW
Sbjct:   22 NMEGLGKCFSSYADDGTHETHRYYLSRRTVLEMLRDRGYSVPSSEIDLSLQEFRAIHGPNPDIDRLKFSATHTSDPSKRMLVLFGGPGIIKVSTIRAIAGQIVNKDSLTGLILVLQNQITNQAMKAVDLFKFKVEMFQITDLLVNITKHVLKPKHQVLTDREKQKLLKDYCIEEKQLPRLLRKDAIARYYGLEKGQVVKVTYSGEITESHVTYRCVW 238          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: A0A067K1X8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22486 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 9.206e-119
Identity = 168/225 (74.67%), Postives = 196/225 (87.11%), Query Frame = -2
Query:  192 GLEGDGS-NGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 863
            G E +GS +  ALG+CLS   D+GS ES RY+LSRRTVLEML+DRGYA+P+ +I++SL EFRAIHGQ PD DRLK+S  HK++ +KRMLV+F GPGVVKVS +R+IA  I +K+ LTGLILI+QN ITNQALKA+DLF FKVE+FQITDLLVNITKHVLKP+H VLTE EKQ+LL+KYSIEEKQLPRLLKKDAIARYYG EKGQV+KVTY G+ITESHVTYRCVW
Sbjct:   14 GAETNGSFDMGALGRCLSSYGDEGSAESCRYYLSRRTVLEMLKDRGYAIPSVDINISLQEFRAIHGQDPDIDRLKISAIHKSNPNKRMLVIFCGPGVVKVSSVRVIAAQIVNKDILTGLILILQNQITNQALKAMDLFKFKVEMFQITDLLVNITKHVLKPKHEVLTEREKQKLLKKYSIEEKQLPRLLKKDAIARYYGLEKGQVVKVTYSGDITESHVTYRCVW 238          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Match: B9IHS9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0016s03800g PE=4 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 7.967e-115
Identity = 162/221 (73.30%), Postives = 196/221 (88.69%), Query Frame = -2
Query:  192 DGSNG-EALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 851
            +GS G E+LG+CLS  VD+GSTESHRY+LSRRTVLEML+DRGY+VP++EID+SL +FR ++GQ+PD + LK S THK+D SKRMLV+F G GVVKV  IRLI   IT +++LTGLIL++QN+ITNQA+KALDLF FK+EIFQITDLLVNITKH+LKP+H+VL+E  KQRLL+KYSIEEKQLPRLLKKDAI+RYYG E+GQV+KVTY G+IT SHVTYRCVW
Sbjct:   23 NGSFGMESLGRCLSSFVDEGSTESHRYYLSRRTVLEMLKDRGYSVPSSEIDISLQDFRGVYGQNPDIELLKFSATHKSDPSKRMLVIFCGLGVVKVGMIRLITVQITDRDSLTGLILVLQNNITNQAMKALDLFKFKIEIFQITDLLVNITKHILKPKHQVLSEQAKQRLLKKYSIEEKQLPRLLKKDAISRYYGLERGQVVKVTYDGDITGSHVTYRCVW 243          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPE5A_ARATH (DNA-directed RNA polymerase V subunit 5A OS=Arabidopsis thaliana GN=NRPE5A PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 5.800e-101
Identity = 138/210 (65.71%), Postives = 175/210 (83.33%), Query Frame = -2
Query:  192 CLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCVW 821
            CLS  VD  S ESHRY+L+RR  L+MLRDRGY V + +I+LSLH+FR ++G+ PD DRL++S  H++DS+K++ +VF+G  +VKV+ IR +   I S+ET+TGLIL++QNH+TNQALKA++LFSFKVEIFQITDLLVNITKH LKPQH+VL + EK  LL+K+SIEEKQLPR+ KKDAI RYYG EKGQV+KV Y GE+TESHV +RCVW
Sbjct:   13 CLSKYVDLSSEESHRYYLARRNGLQMLRDRGYEVSDEDINLSLHDFRTVYGERPDVDRLRISALHRSDSTKKVKIVFFGTSMVKVNAIRSVVADILSQETITGLILVLQNHVTNQALKAIELFSFKVEIFQITDLLVNITKHSLKPQHQVLNDEEKTTLLKKFSIEEKQLPRISKKDAIVRYYGLEKGQVVKVNYRGELTESHVAFRCVW 222          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPD5B_ARATH (DNA-directed RNA polymerases IV and V subunit 5B OS=Arabidopsis thaliana GN=NRPD5B PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 6.673e-91
Identity = 126/204 (61.76%), Postives = 169/204 (82.84%), Query Frame = -2
Query:  195 VDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 806
            +   S E H+Y+L+RRT +EMLRDRGY V + +I+LSL +FRA++G+ PD D L++S  H+ DSSK++ VVF G G+VKV+ +R+IA  + S+E +TGLIL++Q+HITNQALKA++LFSFKVE+F+ITDLLVN++KHVL+P+H+VL + EK+ LL+K+SIEEKQLPRL  KD I RYYG E GQV+KVTY  E++ESHVTYRCV
Sbjct:   14 ISKSSVECHKYYLARRTTMEMLRDRGYDVSDEDINLSLQQFRALYGEHPDVDLLRISAKHRFDSSKKISVVFCGTGIVKVNAMRVIAADVLSRENITGLILVLQSHITNQALKAVELFSFKVELFEITDLLVNVSKHVLRPKHQVLNDKEKESLLKKFSIEEKQLPRLSSKDPIVRYYGLETGQVMKVTYKDELSESHVTYRCV 217          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPE5C_ARATH (DNA-directed RNA polymerase V subunit 5C OS=Arabidopsis thaliana GN=NRPE5C PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.305e-60
Identity = 97/219 (44.29%), Postives = 144/219 (65.75%), Query Frame = -2
Query:  195 DGSNGEALGKCLSGLVDDGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 851
            DG+N      C+S   D G  ES R++L+R T  EMLRDRGY V   E+ L+L EFR++ G+ P+ +RL++ V  ++D  K++LVVF G   + V  +R +   I++   L  +IL++Q+ + + A KAL  F F VE F I DLLVNITKH+ +P+  +L + EK++LL+K+++E+KQLP L +KD+  RYYG +K QV+K+TY  E     VTYRC+
Sbjct:   20 DGTN------CISKTEDTGGIESKRFYLARTTAFEMLRDRGYEVNEAELSLTLSEFRSVFGEKPELERLRICVPLRSDPKKKILVVFMGTEPITVKSVRALHIQISNNVGLHAMILVLQSKMNHFAQKALTTFPFTVETFPIEDLLVNITKHIQQPKIEILNKEEKEQLLRKHALEDKQLPYLQEKDSFVRYYGLKKKQVVKITYSKEPVGDFVTYRCI 232          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPB5A_ARATH (DNA-directed RNA polymerases II and IV subunit 5A OS=Arabidopsis thaliana GN=NRPB5A PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.643e-34
Identity = 71/200 (35.50%), Postives = 120/200 (60.00%), Query Frame = -2
Query:  195 ESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDRLKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFS--FKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 788
            E  R +  ++T+++MLRDRGY + ++E+ ++  +F   HG +   + L      + D+S ++ + F     V V  +++    + S E +   IL+VQ ++T  A   +   S  F +E+FQ  ++LVNI +HVL P+H+VLT  EK+ LL++Y+++E QLPR+   D IARY+G ++GQV+K+    E    +VTYR V
Sbjct:    6 ELKRLYRIQKTLMQMLRDRGYFIADSELTMTKQQFIRKHGDNMKREDLVTLKAKRNDNSDQLYIFFPDEAKVGVKTMKMYTNRMKS-ENVFRAILVVQQNLTPFARTCISEISSKFHLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKKTLLERYTVKETQLPRIQVTDPIARYFGLKRGQVVKIIRPSETAGRYVTYRYV 204          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_PONAB (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Pongo abelii GN=POLR2E PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.428e-33
Identity = 73/209 (34.93%), Postives = 117/209 (55.98%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFK--VEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+T++++  DRGY V   E+D +L EFRA  G  P   R     L + V H  D + +M V F     V +  I++    +  +E +T  +++VQ  +T  A ++L   + K  +E F   +LL+NIT+H L P+H V+T+ E   LL +Y + E QLPR+   D +ARY+G ++GQV+K+    E    ++TYR V
Sbjct:    2 DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFRAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM-QEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_HUMAN (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens GN=POLR2E PE=1 SV=4)

HSP 1 Score: 125.946 bits (315), Expect = 1.084e-32
Identity = 72/209 (34.45%), Postives = 117/209 (55.98%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFK--VEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+T++++  DRGY V   E+D +L EF+A  G  P   R     L + V H  D + +M V F     V +  I++    +  +E +T  +++VQ  +T  A ++L   + K  +E F   +LL+NIT+H L P+H V+T+ E   LL +Y + E QLPR+   D +ARY+G ++GQV+K+    E    ++TYR V
Sbjct:    2 DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM-QEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_RAT (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Rattus norvegicus GN=Polr2e PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.201e-32
Identity = 72/209 (34.45%), Postives = 118/209 (56.46%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKAL-DLFS-FKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+T++++  DRGY V   E+D +L EF+A  G  P   R     L + V H  D + +M V F     V +  I++    +  +E +T  +++VQ  +T  A ++L D+   + +E F   +LL+NIT+H L P+H V+T+ E   LL +Y + E QLPR+   D +ARY+G ++GQV+K+    E    ++TYR V
Sbjct:    2 DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM-QEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_MOUSE (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Mus musculus GN=Polr2e PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.201e-32
Identity = 72/209 (34.45%), Postives = 118/209 (56.46%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKAL-DLFS-FKVEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+T++++  DRGY V   E+D +L EF+A  G  P   R     L + V H  D + +M V F     V +  I++    +  +E +T  +++VQ  +T  A ++L D+   + +E F   +LL+NIT+H L P+H V+T+ E   LL +Y + E QLPR+   D +ARY+G ++GQV+K+    E    ++TYR V
Sbjct:    2 DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM-QEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_CAEEL (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis elegans GN=rpb-5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.218e-32
Identity = 70/209 (33.49%), Postives = 117/209 (55.98%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLITSKETLTGLILIVQNHITNQALKALDLFSFK--VEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+TVL+M+ DRGY V   E+D  L  F+  +G  P   +     L + V H  D + +M V F     + +  I+ I   +  ++ ++  I++VQ  +T  A +++   + K  +E F   +L+VNIT+H L P+H V+T  EK  LL +Y +++ QLPR+ + D +ARY+G  +GQV+K+    E    ++TYR V
Sbjct:    3 DDELETYRLWRIRKTVLQMVHDRGYLVAQDELDQPLETFKVQYGDRPSEKKPARSDLTILVAHNDDPADQMFVFFPEDAKIGIKTIKAICQQM-QEQNISRAIIVVQTGMTPSAKQSIGDMAPKYMLEHFLEAELMVNITEHELVPEHVVMTAEEKAELLARYKLKDSQLPRIQQCDPVARYFGLRRGQVVKIIRPSETAGRYITYRLV 210          
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Match: RPAB1_CAEBR (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis briggsae GN=rpb-5 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.473e-32
Identity = 73/211 (34.60%), Postives = 118/211 (55.92%), Query Frame = -2
Query:  195 DGSTESHRYFLSRRTVLEMLRDRGYAVPNTEIDLSLHEFRAIHGQSPDFDR-----LKLSVTHKTDSSKRMLVVFYGPGVVKVSGIRLIAGLI--TSKETLTGLILIVQNHITNQALKALDLFSFK--VEIFQITDLLVNITKHVLKPQHRVLTEHEKQRLLQKYSIEEKQLPRLLKKDAIARYYGFEKGQVIKVTYGGEITESHVTYRCV 800
            D   E++R +  R+TVL+M+ DRGY V   E+D  L  F+   G  P   +     L + V H  D + +M V F  P   K+ GI+ I  +     ++ ++  I++VQ  +T  A +++   + K  +E F   +L+VNIT+H L P+H V+T  EK  LL +Y +++ QLPR+ + D +ARY+G  +GQV+K+    E    ++TYR V
Sbjct:    3 DDELETYRLWRIRKTVLQMVHDRGYLVAQEELDQPLETFKETFGDRPSEKKPARSDLTILVAHNDDPADQMFVFF--PEDTKI-GIKTIKAICQQMQEQNISRAIIVVQTGMTPSAKQSIGDMAPKYMLEHFLEAELMVNITEHELVPEHVVMTAEEKAELLARYKLKDSQLPRIQQCDPVARYFGLRRGQVVKIIRPSETAGRYITYRLV 210          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0Q234_GOSAR6.202e-163100.00Dna-directed rna polymerases i, ii, and iii subuni... [more]
A0A0D2NJ30_GOSRA2.412e-16199.12Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RU93_GOSRA1.196e-15998.69Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EW60_THECC1.492e-14588.16Eukaryotic rpb5 RNA polymerase subunit family prot... [more]
A0A0D2SP67_GOSRA6.827e-13093.14Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RMD1_GOSRA4.793e-12898.93Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q0F3_GOSRA1.200e-12798.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9ST46_RICCO1.510e-11976.04DNA-directed RNA polymerase II, putative OS=Ricinu... [more]
A0A067K1X8_JATCU9.206e-11974.67Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9IHS9_POPTR7.967e-11573.30Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0021466 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
RPE5A_ARATH5.800e-10165.71DNA-directed RNA polymerase V subunit 5A OS=Arabid... [more]
RPD5B_ARATH6.673e-9161.76DNA-directed RNA polymerases IV and V subunit 5B O... [more]
RPE5C_ARATH2.305e-6044.29DNA-directed RNA polymerase V subunit 5C OS=Arabid... [more]
RPB5A_ARATH4.643e-3435.50DNA-directed RNA polymerases II and IV subunit 5A ... [more]
RPAB1_PONAB3.428e-3334.93DNA-directed RNA polymerases I, II, and III subuni... [more]
RPAB1_HUMAN1.084e-3234.45DNA-directed RNA polymerases I, II, and III subuni... [more]
RPAB1_RAT1.201e-3234.45DNA-directed RNA polymerases I, II, and III subuni... [more]
RPAB1_MOUSE1.201e-3234.45DNA-directed RNA polymerases I, II, and III subuni... [more]
RPAB1_CAEEL1.218e-3233.49DNA-directed RNA polymerases I, II, and III subuni... [more]
RPAB1_CAEBR2.473e-3234.60DNA-directed RNA polymerases I, II, and III subuni... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005571RNA polymerase, Rpb5, N-terminalGENE3D3.40.1340.10coord: 32..162
e-value: 9.7E-30
score: 102.9
IPR005571RNA polymerase, Rpb5, N-terminalPFAMPF03871RNA_pol_Rpb5_Ncoord: 36..117
e-value: 2.1E-19
score: 69.7
IPR005571RNA polymerase, Rpb5, N-terminalSUPERFAMILY53036Eukaryotic RPB5 N-terminal domaincoord: 36..163
IPR014381DNA-directed RNA polymerase RPB5 subunit, eukaryote/virusPIRSFPIRSF000747RPB5coord: 30..235
e-value: 4.5E-75
score: 249.3
IPR000783RNA polymerase, subunit H/Rpb5 C-terminalPFAMPF01191RNA_pol_Rpb5_Ccoord: 162..234
e-value: 3.3E-28
score: 97.2
IPR000783RNA polymerase, subunit H/Rpb5 C-terminalGENE3D3.90.940.20coord: 163..235
e-value: 4.9E-28
score: 96.1
IPR000783RNA polymerase, subunit H/Rpb5 C-terminalPRODOMPD005155coord: 169..234
e-value: 1.0E-20
score: 245.0
IPR000783RNA polymerase, subunit H/Rpb5 C-terminalSUPERFAMILY55287RPB5-like RNA polymerase subunitcoord: 160..235
NoneNo IPR availablePANTHERPTHR10535:SF2DNA-DIRECTED RNA POLYMERASE V SUBUNIT 5A-RELATEDcoord: 33..235
NoneNo IPR availablePANTHERPTHR10535DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1coord: 33..235

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0021466 ID=g.arboreum_cottongen_reftransV1_0021466|Name=g.arboreum_cottongen_reftransV1_0021466|organism=Gossypium arboreum|type=contig|length=960bp
GCCAACAGACATTATAGATTTCAAAGTAAAATTAAATAAGAATCCACTCA
ATCAGTGTTCATAAAACAGCAAACAAAGGTCGGAAGCCCCATAGAAAGGT
TTGGGAAACCACTTCTGAAAGAAAACTACAAACGCAATTTTCCTACAGGA
AGAAACATAAAGAAAAGCGACAGCATTGATTTGTTTCATCACCAGACGCA
TCGATAAGTAACATGTGACTCAGTGATTTCACCCCCATATGTAACTTTTA
TCACCTGACCCTTTTCAAAACCGTAGTATCTTGCAATGGCATCTTTTTTT
AACAGTCGAGGGAGCTGTTTTTCTTCTATGCTGTACTTCTGCAATAGTCT
TTGTTTCTCATGTTCTGTTAGTACCCGGTGCTGGGGCTTCAGCACATGCT
TTGTGATATTAACAAGTAGGTCAGTAATCTGGAATATCTCCACCTTAAAT
GAGAAAAGGTCTAAAGCTTTCAAAGCTTGGTTTGTTATGTGGTTTTGCAC
GATTAATATCAACCCGGTCAAAGTTTCTTTGCTAGTAATTAGACCAGCAA
TGAGCCGAATCCCACTGACTTTAACTACACCAGGCCCATAGAAAACTACC
AGCATCCGCTTGGAAGAGTCAGTTTTATGAGTAACAGAGAGTTTGAGACG
ATCAAAATCAGGGCTTTGGCCATGAATGGCACGAAATTCATGGAGAGAGA
GGTCGATTTCAGTGTTGGGTACGGCATAGCCTCTGTCCCTAAGCATCTCC
AGCACAGTTCTCCGGGACAGGAAGTATCGATGACTCTCGGTGCTACCATC
GTCCACCAACCCACTCAAGCACTTCCCAAGAGCTTCCCCGTTTGACCCAT
CTCCTTCCAATCCAATCCCTTCCATTTTCACTTTTACTTCAACCAGTCTA
CGAGTTCAGTATTTACACGACTTAACTACGCTTCCGCTTCGTTTTCCTCG
ACTGTCTCAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR005571RNA_pol_Rpb5_N
IPR014381DNA_RNA_pol_RPB5_euk/virus
IPR000783RNA_pol_subH/Rpb5_C
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003899DNA-directed RNA polymerase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-dependent