g.arboreum_cottongen_reftransV1_0005590, g.arboreum_cottongen_reftransV1_0005590 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0005590
Unique Nameg.arboreum_cottongen_reftransV1_0005590
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2426
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0005590:1..2426 .
Chr11:73446004..73450133 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A0D2Q9T2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G138200 PE=4 SV=1)

HSP 1 Score: 1310.82 bits (3391), Expect = 0.000e+0
Identity = 652/700 (93.14%), Postives = 663/700 (94.71%), Query Frame = 2
Query:  104 MFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
            MFRPY+YGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSV+PVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKG+VSVNHGSMQCDLHLNAKKSKLVA P CTIQAVAELPIHLH DDE+LEDESQRIMKVTEI TNNLGKVSQIGEG++DLCVASRTPGL                        MVEQKHGDIICPNVVI+ESSPVENGAPVKESSGD GGNID DFTSSSQNS SADGLQENVDL GEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQ MASQDPVQNADWTEQNSCVKCNQNG+LLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEG DILKEVVGPQITDA QKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFS TRRLRRKKAPWTNDEEEML+KG+QE+ANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCK SPGCK
Sbjct:    1 MFRPYTYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVSPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGVVSVNHGSMQCDLHLNAKKSKLVANPTCTIQAVAELPIHLHGDDEQLEDESQRIMKVTEIETNNLGKVSQIGEGDQDLCVASRTPGL------------------------MVEQKHGDIICPNVVIDESSPVENGAPVKESSGDAGGNIDQDFTSSSQNSTSADGLQENVDLIGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQRMASQDPVQNADWTEQNSCVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGHDILKEVVGPQITDARQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSTTRRLRRKKAPWTNDEEEMLKKGLQEIANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKGSPGCK 676          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A0B0N1I3_GOSAR (PHD finger 21B OS=Gossypium arboreum GN=F383_33544 PE=4 SV=1)

HSP 1 Score: 1298.49 bits (3359), Expect = 0.000e+0
Identity = 650/667 (97.45%), Postives = 650/667 (97.45%), Query Frame = 2
Query:  203 LIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
            LIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIHLHDDDERLEDESQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDK                 SFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK
Sbjct:   36 LIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIHLHDDDERLEDESQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDK-----------------SFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 685          

HSP 2 Score: 67.781 bits (164), Expect = 2.153e-8
Identity = 34/42 (80.95%), Postives = 35/42 (83.33%), Query Frame = 3
Query:   66 LKVNQVLALDLVRCFALTLMVQELHGFGSLSTYQAFPS*IFP 191
            LKVNQVLALDLVRCFALTLMVQELHGFGSLS  +  P  I P
Sbjct:    5 LKVNQVLALDLVRCFALTLMVQELHGFGSLSLIETAP--ILP 44          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A0D2RW48_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G138200 PE=4 SV=1)

HSP 1 Score: 1209.9 bits (3129), Expect = 0.000e+0
Identity = 605/650 (93.08%), Postives = 614/650 (94.46%), Query Frame = 2
Query:  104 MFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLR 2053
            MFRPY+YGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSV+PVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKG+VSVNHGSMQCDLHLNAKKSKLVA P CTIQAVAELPIHLH DDE+LEDESQRIMKVTEI TNNLGKVSQIGEG++DLCVASRTPGL                        MVEQKHGDIICPNVVI+ESSPVENGAPVKESSGD GGNID DFTSSSQNS SADGLQENVDL GEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQ MASQDPVQNADWTEQNSCVKCNQNG+LLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEG DILKEVVGPQITDA QKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFS TRRLRRKKAPWTNDEEEML+
Sbjct:    1 MFRPYTYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVSPVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGVVSVNHGSMQCDLHLNAKKSKLVANPTCTIQAVAELPIHLHGDDEQLEDESQRIMKVTEIETNNLGKVSQIGEGDQDLCVASRTPGL------------------------MVEQKHGDIICPNVVIDESSPVENGAPVKESSGDAGGNIDQDFTSSSQNSTSADGLQENVDLIGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQRMASQDPVQNADWTEQNSCVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGHDILKEVVGPQITDARQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSTTRRLRRKKAPWTNDEEEMLK 626          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A0D2SXL5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G138200 PE=4 SV=1)

HSP 1 Score: 1110.13 bits (2870), Expect = 0.000e+0
Identity = 556/605 (91.90%), Postives = 566/605 (93.55%), Query Frame = 2
Query:  389 ILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
             L +VPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKG+VSVNHGSMQCDLHLNAKKSKLVA P CTIQAVAELPIHLH DDE+LEDESQRIMKVTEI TNNLGKVSQIGEG++DLCVASRTPGL                        MVEQKHGDIICPNVVI+ESSPVENGAPVKESSGD GGNID DFTSSSQNS SADGLQENVDL GEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQ MASQDPVQNADWTEQNSCVKCNQNG+LLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEG DILKEVVGPQITDA QKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFS TRRLRRKKAPWTNDEEEML+KG+QE+ANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCK SPGCK
Sbjct:   10 FLYQVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEELLGRNPIPSKRSRDELVAGNSKGVVSVNHGSMQCDLHLNAKKSKLVANPTCTIQAVAELPIHLHGDDEQLEDESQRIMKVTEIETNNLGKVSQIGEGDQDLCVASRTPGL------------------------MVEQKHGDIICPNVVIDESSPVENGAPVKESSGDAGGNIDQDFTSSSQNSTSADGLQENVDLIGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQRMASQDPVQNADWTEQNSCVKCNQNGQLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGHDILKEVVGPQITDARQKLVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSTTRRLRRKKAPWTNDEEEMLKKGLQEIANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKGSPGCK 590          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A061EX00_THECC (RING/FYVE/PHD zinc finger superfamily protein, putative isoform 1 OS=Theobroma cacao GN=TCM_024753 PE=4 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 320/554 (57.76%), Postives = 392/554 (70.76%), Query Frame = 2
Query:   95 LGPMFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPV-SRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEE------LLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFM-GLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHK 1732
            +G M   +S GP   WLWIIEY+SSF Q+D SII GLIE AP+LP+DL +NT E +ALRCLEELFGP N    VAP  SR V + +ASC+DVL HI+    Q+V LS+L+ AGPELLRWD H FI HKRA+LPKCALEQLKD IL + P LDG+EN P  R DDS+DENGN+EGNLIPQ  K++       LL RN IP KR + +LVAGN  G+VS N   M  D  +NAKK K  A   CTIQ+V ++PI LH  ++  E  S +I+KVTEI  NNLGK SQ GEG+ D+ V SRT G  DAVG VEL DN+MEN QN   D+M EQK+G     NV+++ES+ VENGA  K   GD   N D  F   S NS SA GLQ+N++ +  KADM+HPC E++CE  DE FNI+L K+LFLSSQ + SQDP+  + WTEQ  CVKCN+NG++LVC+SSGC L VHESCL  PARFDDKG+F CPFC CSVSI+ YLEAK+K  LARK+L AF+     KL ++Q +  +H +LN +E+L GIQ +GHLG E +HK
Sbjct:   82 IGRMLGMFSSGPSLPWLWIIEYLSSFRQIDTSIIRGLIEAAPVLPDDLGKNTREMIALRCLEELFGPTNGLRDVAPPDSRVVFDLAASCEDVLKHIV----QEVSLSNLRKAGPELLRWDVHPFIMHKRASLPKCALEQLKDSILEETPVLDGDENTPTWRLDDSDDENGNREGNLIPQTHKDDNEVLQDGLLERNLIPIKRCKSDLVAGNLVGLVSCNQDGMHNDFPVNAKKFKQDA--TCTIQSVEKIPIPLHGVEQLDE--SGKIIKVTEIEGNNLGKDSQAGEGDEDVFVVSRTLGQSDAVGHVELQDNEMENAQN--ADIMGEQKYGYRPSKNVMMDESNHVENGALEKSPGGDASENFDQGFPLYSLNSTSAVGLQQNIEPDEAKADMEHPCAEKMCEYVDERFNIALNKSLFLSSQCIPSQDPLGKSGWTEQKFCVKCNKNGQVLVCSSSGCPLVVHESCLGSPARFDDKGNFYCPFCVCSVSITKYLEAKDKTSLARKELDAFLEHCSKKLTEQQWKLQSHLRLNVDEDLVGIQMNGHLG-ESKHK 624          

HSP 2 Score: 189.889 bits (481), Expect = 4.303e-47
Identity = 95/163 (58.28%), Postives = 121/163 (74.23%), Query Frame = 2
Query: 1715 REHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLV---NSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSP 2194
            REHEH+Q++LP   K SDDNP  ENT+T   NQVEV G ++ KE V PQIT+  QK V   N DGEES T+A+DK+I+SS+S R +K ET+ +F P  +LRRKK PWT +EEEMLR+ V++ A+  GTVPWK+IL+ GT+VFL  RT  DLK+KWR+MCK  P
Sbjct:  678 REHEHQQDQLPDNRKYSDDNPAGENTKTILENQVEVGGKNV-KEAVQPQITNPPQKPVCAFNGDGEESPTAANDKFIVSSYSIRLRKRETKCTFPPIPQLRRKKLPWTKNEEEMLRREVEKYASHGGTVPWKKILDMGTSVFLSGRTTVDLKDKWRNMCKGGP 839          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A061EY27_THECC (RING/FYVE/PHD zinc finger superfamily protein, putative isoform 2 OS=Theobroma cacao GN=TCM_024753 PE=4 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 320/554 (57.76%), Postives = 392/554 (70.76%), Query Frame = 2
Query:   95 LGPMFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPV-SRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKNEE------LLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFM-GLMGKLIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHK 1732
            +G M   +S GP   WLWIIEY+SSF Q+D SII GLIE AP+LP+DL +NT E +ALRCLEELFGP N    VAP  SR V + +ASC+DVL HI+    Q+V LS+L+ AGPELLRWD H FI HKRA+LPKCALEQLKD IL + P LDG+EN P  R DDS+DENGN+EGNLIPQ  K++       LL RN IP KR + +LVAGN  G+VS N   M  D  +NAKK K  A   CTIQ+V ++PI LH  ++  E  S +I+KVTEI  NNLGK SQ GEG+ D+ V SRT G  DAVG VEL DN+MEN QN   D+M EQK+G     NV+++ES+ VENGA  K   GD   N D  F   S NS SA GLQ+N++ +  KADM+HPC E++CE  DE FNI+L K+LFLSSQ + SQDP+  + WTEQ  CVKCN+NG++LVC+SSGC L VHESCL  PARFDDKG+F CPFC CSVSI+ YLEAK+K  LARK+L AF+     KL ++Q +  +H +LN +E+L GIQ +GHLG E +HK
Sbjct:    4 IGRMLGMFSSGPSLPWLWIIEYLSSFRQIDTSIIRGLIEAAPVLPDDLGKNTREMIALRCLEELFGPTNGLRDVAPPDSRVVFDLAASCEDVLKHIV----QEVSLSNLRKAGPELLRWDVHPFIMHKRASLPKCALEQLKDSILEETPVLDGDENTPTWRLDDSDDENGNREGNLIPQTHKDDNEVLQDGLLERNLIPIKRCKSDLVAGNLVGLVSCNQDGMHNDFPVNAKKFKQDA--TCTIQSVEKIPIPLHGVEQLDE--SGKIIKVTEIEGNNLGKDSQAGEGDEDVFVVSRTLGQSDAVGHVELQDNEMENAQN--ADIMGEQKYGYRPSKNVMMDESNHVENGALEKSPGGDASENFDQGFPLYSLNSTSAVGLQQNIEPDEAKADMEHPCAEKMCEYVDERFNIALNKSLFLSSQCIPSQDPLGKSGWTEQKFCVKCNKNGQVLVCSSSGCPLVVHESCLGSPARFDDKGNFYCPFCVCSVSITKYLEAKDKTSLARKELDAFLEHCSKKLTEQQWKLQSHLRLNVDEDLVGIQMNGHLG-ESKHK 546          

HSP 2 Score: 189.119 bits (479), Expect = 3.422e-47
Identity = 95/163 (58.28%), Postives = 121/163 (74.23%), Query Frame = 2
Query: 1715 REHEHKQEELPAKLKTSDDNPTTENTETFPINQVEVEGDDILKEVVGPQITDASQKLV---NSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSP 2194
            REHEH+Q++LP   K SDDNP  ENT+T   NQVEV G ++ KE V PQIT+  QK V   N DGEES T+A+DK+I+SS+S R +K ET+ +F P  +LRRKK PWT +EEEMLR+ V++ A+  GTVPWK+IL+ GT+VFL  RT  DLK+KWR+MCK  P
Sbjct:  600 REHEHQQDQLPDNRKYSDDNPAGENTKTILENQVEVGGKNV-KEAVQPQITNPPQKPVCAFNGDGEESPTAANDKFIVSSYSIRLRKRETKCTFPPIPQLRRKKLPWTKNEEEMLRREVEKYASHGGTVPWKKILDMGTSVFLSGRTTVDLKDKWRNMCKGGP 761          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A0A061GYX1_THECC (RING/FYVE/PHD zinc finger superfamily protein, putative OS=Theobroma cacao GN=TCM_042306 PE=4 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 4.342e-134
Identity = 251/540 (46.48%), Postives = 320/540 (59.26%), Query Frame = 2
Query:   95 LGPMFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSV-APVSRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVILLDDPYLDGNENGPPSRSDDSNDENGNQEGNLIPQIKKN------EELLGRNPIPSKRSRDELVAGNSKGIVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNTDMMVEQKHGDIICPNVVINESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRS-WNHSKLNGNENLAG 1690
            LG M    S G    WLWIIEY+SSF ++D SII GLIE AP+LP  L  NT+E V+LRCLEELFGP+N    V  P SR V + S SC DVL  IL    Q+V +SDLK AGP+LLRWD H FI HKRA+   CALEQLKD +  D P +DG+E+ P        DENG+ EGNL+P    N      + LL  N IPSKR   ++ A N  G+ S N   M     L  K+ K     +C+ Q+V ++PI LH                   G   + K SQ  E +RD  V SRT G  D V  V+  DNQ+ N QN    M+ E+ +GD    N+ + E +  E+G+  K  SGD   N+D  F  SS    SAD  Q+ +D +    D +HPC EQ+ EDE    +++LKK+L LSS+  +SQDP+  ADW EQN C KC ++GR+LVC+S+ C + VHESC   PARFDDKG+F CP+CA SVSIS YLEAK K+ LAR++L AFM L  K++ E+ R    H +LNG+E L G
Sbjct:    4 LGSMLGFSSPGSSLPWLWIIEYLSSFSKIDTSIIRGLIEAAPVLPHGLGTNTTEMVSLRCLEELFGPENDFKDVDVPDSRVVFDLSESCKDVLKQIL----QEVSVSDLKKAGPKLLRWDVHPFIMHKRASQRTCALEQLKDSMFKDIPVIDGDEDAP-------KDENGDGEGNLVPHGHGNRNDVLQDGLLEGNLIPSKRYITDVDADNLVGLDSGNPNGMFNHNDLQLKEKKFKQDGSCSNQSVGQIPIPLH-------------------GNEQVQKDSQANEVDRDGRVTSRTVGQSDGVFHVKFQDNQIGNAQN--AGMVGEEMYGDTASQNISMIEPNHFESGSLQKVPSGDSHDNVDQVFPLSSPKPASADVFQQKIDSDEANVDFEHPCTEQLYEDER--LDVALKKSLSLSSRCTSSQDPLGAADWIEQNLCFKCTKSGRVLVCSSNDCPIVVHESCFGTPARFDDKGNFRCPYCAYSVSISQYLEAKGKVTLAREELCAFMELFAKILPEEKRKPHGHPRLNGDEGLVG 509          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: A5B054_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_016915 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 4.186e-95
Identity = 257/783 (32.82%), Postives = 384/783 (49.04%), Query Frame = 2
Query:  140 WLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELF-GPQNSHGSVAPV--SRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVIL-----------------------LDDPYLDGNENGPPSRSDDSN--DENGNQEGNLIPQIKKNEELL------GRNPIPSKRSRDELVAGNSKG-----IVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKV---SQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNT---DMMVEQKHGDI-------------ICPNVVI--------------------------NESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICED----EDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGK---LIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFP-INQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSAD--DKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANE-DGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
            WLW++E ++SF ++DIS++  L+  AP + ++L  N  E +ALRCLE LF G  N    V PV  S+   +PS SC+DVL  IL    +KV  S L+   PELL+W+ + FI HKRA LPKCAL++LKD IL                          P  DG+      R D+     +    +G+LIP   +NE  L       R  +P KR  D+L A N  G     + SVN+G    D H NAK+ K  A   C+I ++   P+ LH      +     I +      + LG +   + + E + D  V S+    I  V   E   NQ +   + N    +M  ++ H DI             + PN  I                          N+SS   + +  K S  +   + DH     + N    +     V ++  K D +H C E++  D     DE   I++++  FLSS+   + D +  A WTEQN C+KC ++G+LLVC+SSGC L VHE+CL CP  FD+ G+F CPFCA S ++S YLE+K K+ LA+K+L +F+    K   +  ++     + KLN + NL  + E+GH+  + + +     A++    D     N E    + +  V    + +E +  QI+D  +         S TS D  DK   S++  R ++ + + +F P  +LRRKK  WT  EEE+L+ GVQ+ +N+ D ++PWK+I+EFG  VF   RT  DLK+KWR++CK SP  K
Sbjct:   13 WLWVMETLASFERVDISLLKDLMIKAPEVSDNLGRNVKEMIALRCLEALFSGITND---VHPVVHSKMGFDPSESCEDVLQCIL----RKVSASKLRMGEPELLKWNVNPFIAHKRACLPKCALQELKDTILEGSHPSAXSLKERSGLRFESQCETRTPNGDGDSGAVAPRVDEGTACGQVEAAKGDLIPLTAENENNLLPEDTTERILLPYKRGLDDLPAKNLMGQFNPNVDSVNYGG---DSHSNAKRRKHDA--FCSITSIEPNPVSLHGKKLLEDSSRPSINECDLAKESQLGDLEGSTMVSEDDHDKYVVSKRVEQITDVEHGEFEHNQTQIPFHSNKMPQNMPRDESHHDISVDEAKDDDVEHWVEPNKSIGAASDGSQQKTAVDEAKDDGDCRVEPNKSSGSSDESQKKNSVDEAKDDGDHSSQPKASNDKLPNEAHHKVFVDEAKDDTEHCCEEEMLSDSTEYHDEEDGIAMERQNFLSSKCTFNHDSLSIAGWTEQNLCMKCTKDGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAYSRAVSEYLESKKKVSLAKKELASFINAGMKHEPVKPKKKHRKKNEKLNESANLVKVCENGHVKEKRQTRANHGDAQVT---DQLIRRNVEKHDGVEEQGVANLGVQQEALQQQISDPLEDPA------SGTSGDENDKPSSSTYYIRFRRQQQQYTFPPIHQLRRKKLAWTAKEEEILKVGVQKFSNDHDKSIPWKKIMEFGGTVFQRGRTTIDLKDKWRNICKGSPKSK 774          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: D7THZ7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g08160 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 4.545e-95
Identity = 256/783 (32.69%), Postives = 384/783 (49.04%), Query Frame = 2
Query:  140 WLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELF-GPQNSHGSVAPV--SRAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATLPKCALEQLKDVIL-----------------------LDDPYLDGNENGPPSRSDDSN--DENGNQEGNLIPQIKKNEELL------GRNPIPSKRSRDELVAGNSKG-----IVSVNHGSMQCDLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKV---SQIGEGNRDLCVASRTPGLIDAVGRVELLDNQMENVQNDNT---DMMVEQKHGDI-------------ICPNVVI--------------------------NESSPVENGAPVKESSGDVGGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDHPCVEQICEDEDEIFN----ISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGK---LIQEQGRSWNHSKLNGNENLAGIQESGHLGREHEHKQEELPAKLKTSDDNPTTENTETFP-INQVEVEGDDILKEVVGPQITDASQKLVNSDGEESSTSAD--DKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANE-DGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
            WLW++E ++SF ++DIS++  L+  AP + ++L  N  E +ALRCLE LF G  N    V PV  S+   +PS SC+DVL  IL    +KV  S L+   PELL+W+ + FI HKRA LPKCAL++LKD IL                          P  DG+      R D+     +    +G+LIP   +NE  L       R  +P KR  D+L A N  G     + SVN+G    D H NAK+ K  A   C+I ++   P+ LH      +     I +      + LG +   + + E + D  V S+    I  V   E   NQ +   + N    +M  ++ H DI             + PN  I                          N+SS   + +  K S  +   + DH     + N    +     V ++  K D +H C E++  D  E  +    I++++  FLSS+   + D +  A WTEQN C+KC ++G+LLVC+SSGC L VHE+CL CP  FD+ G+F CPFCA S ++S YLE+K K+ LA+K+L +F+    K   +  ++     + KLN + NL  + E+GH+  + + +     A++    D     N E    + +  V    + +E +  QI+D  +         S TS D  DK   S++  R ++ + + +F P  +LRRKK  WT  EEE+L+ GVQ+ +N+ D ++PWK+I+EFG  VF   RT  DLK+KWR++CK SP  K
Sbjct:   13 WLWVMETLASFERVDISLLKDLMIKAPEVSDNLGRNVKEMIALRCLEALFSGITND---VHPVVHSKMGFDPSESCEDVLQCIL----RKVSASKLRMGEPELLKWNVNPFIAHKRACLPKCALQELKDTILEGSHPSAVSLKERSGLRFESQCETRTPNGDGDSGAVAPRVDEGTACGQVEAAKGDLIPLTAENENNLLPEDTTERILLPYKRGLDDLPAKNLMGQFNPNVDSVNYGG---DSHSNAKRRKHDA--FCSITSIEPNPVSLHGKKLLEDSSRPSINECDLAKESQLGDLEGSTMVSEDDHDKYVVSKRVEQITDVEHGEFEHNQTQIPFHSNKMPQNMPRDESHHDISVDEAKDDDVEHWVEPNKSIGAASDGSQQKTAVDEAKDDGDCRVEPNKSSGSSDESQKKNSVDEAKDDGDHSSQPKASNDKLPNEAHHKVFVDEAKDDTEHCCEEEMLSDSTEYHDEEDGIAMERQNFLSSKCTFNHDSLSIAGWTEQNLCMKCTKDGQLLVCSSSGCPLVVHENCLGCPPSFDNMGNFYCPFCAYSRAVSEYLESKKKVSLAKKELASFINAGMKHEPVKPKKKHRKKNEKLNESANLVKVCENGHVKEKRQTRANHGDAQVT---DQLIRRNVEKHDGVEEQGVANLGVQQEALQQQISDPLEDPA------SGTSGDENDKPSSSTYYIRFRRQQQQYTFPPIHQLRRKKLAWTAKEEEILKVGVQKFSNDHDKSIPWKKIMEFGGTVFQRGRTTIDLKDKWRNICKGSPKSK 774          
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Match: B9II56_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0016s05370g PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.620e-85
Identity = 259/829 (31.24%), Postives = 399/829 (48.13%), Query Frame = 2
Query:  104 MFRPYSYGPRAAWLWIIEYVSSFPQLDISIISGLIETAPILPEDLEENTSERVALRCLEELFGPQNSHGSVAPVS----RAVLNPSASCDDVLDHILYHILQKVPLSDLKNAGPELLRWDGHSFIEHKRATL-----------------PKCALEQLKDVILLDDP----YLDGNENGPPSRSDDSNDENGN---QEGNLIPQIKKNEELL-----GRNPIPSKRSRDELVAGNSKGIVSVNHGSMQC--DLHLNAKKSKLVAKPACTIQAVAELPIXXXXXXXXXXXXSQRIMKVTEIGTNNLGKVSQIG--EGNRDLCVASRTPGLIDAVGRVELLDNQMENVQND---NTDMMVEQKHGDIICPNVVINESSPVE----NGAPVKESSGDV-----GGNIDHDFTSSSQNSISADGLQENVDLNGEKADMDH----PCVEQICEDEDEIFNISLKKNLFLSSQHMASQDPVQNADWTEQNSCVKCNQNGRLLVCTSSGCLLAVHESCLNCPARFDDKGHFLCPFCACSVSISNYLEAKNKIILARKKLVAFMGLMGKLIQEQGRSWNH-----SKLNGN----------------ENLAGIQES-----GHLGREHEHK----------QEELPAKLKTS----DDNPTTENTETFPINQVEVEGDDILKE--------------------------------VVGPQITDASQK----LVNSDGEESSTSADDKYIISSHSTRSKKSETRQSFSPTRRLRRKKAPWTNDEEEMLRKGVQELANEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMCKDSPGCK 2203
            M  P S     AWLW+IEY++SF Q++ SI+  LIE AP +P+DL +NT E VALRCLE+LF  ++ +G    V+    +   + S SC+DVL  IL    Q+  +SDL   GPELL+WD H FI HKRA +                 P  +L++  +++  +D       D  ++G P      +D +G     E + IP + +NE ++      RN +  +R R    +G++   ++ +H    C    HL  +  +          ++ ++        + +ED  + +++ +E    +L K S  G  EG+  +         ID  G     DN  ++ Q++   N + M     GD +     ++E +  E    N AP   +S  +      G  DH       NS+S++G   N D +  +A  DH        +  E E E  ++ L+K+ FLSSQ+M S D +  A+WT+QN C+KC ++G+LLVC +  C L +HE+CL     FD++G F CPFCA S++IS YLEAK K   ARK+L  F+       +++ RS  H     SK +G+                ENL G +       G +   ++H+           E L + +  +    ++ P   N  T  I+ VE EG+++++E                                V G Q TD  ++     ++SDG E+S   DDK I +++  R +K E RQ      + RRKK PWT  EEE+L++GVQ+ A+ DG  PWK ILE+G++VF   RT  DLK+KWR+MCK SP  K
Sbjct:   18 MDDPSSSATTLAWLWVIEYLASFRQIEPSILHELIEAAPEIPDDLGKNTREMVALRCLEDLFC-RSDNGIANDVTSKELKVTFDLSESCEDVLQSIL----QETSVSDLNRGGPELLKWDIHPFIMHKRACMPKCALEKVKDAILEGIHPYASLKEYSELVNANDRGNRITTDYGDDGAPVGRIGGSDTDGQINPPEESSIPLLHENENVVEDNSYNRNLLHFERER----SGSASQNLAGDHEDQGCVDGDHLQPQAKRFKEDALHDNLSMGQISSTPPQHKDMVEDSFEMVVEDSENRDFHLEKESSQGGLEGSIPVENDHDEDVGIDRHGHSLDADNAFQHNQHEIAHNANKMPLS--GDGLHQYSFVDEINRAEPRKSNAAPSVGTSDRLFVNGNKGKSDHSGQQKPSNSVSSNGFHRNTDADEREAGTDHLSEEDESNESDEYEQERVDVGLRKSHFLSSQYMLSHDSLAEANWTDQNLCIKCCKDGQLLVCGAGSCSLVIHENCLVFSPHFDERGDFYCPFCAYSLAISEYLEAKKKAYSARKELKLFIE-----TRQEYRSNKHTQRLLSKRHGSSRQNEDKDLLNKFLDYENLVGEKRKQSNNRGQISEGNDHQFQKGKGKKKQVEPLASCIGVNSLCREEEPDV-NVRTNHISTVEKEGEEVVQENSSGTELDINQHQVSVDPKYSVDNHLCKEKEIVSGSQRTDGRRQKAVCAISSDGGETSGDEDDKSISTNYFIRFRKRE-RQYTPAMPQSRRKKVPWTAHEEEILKEGVQKFAS-DGKYPWKDILEYGSSVFSNGRTTIDLKDKWRNMCKLSPKSK 827          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2Q9T2_GOSRA0.000e+093.14Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0N1I3_GOSAR2.153e-897.45PHD finger 21B OS=Gossypium arboreum GN=F383_33544... [more]
A0A0D2RW48_GOSRA0.000e+093.08Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SXL5_GOSRA0.000e+091.90Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EX00_THECC4.303e-4757.76RING/FYVE/PHD zinc finger superfamily protein, put... [more]
A0A061EY27_THECC3.422e-4757.76RING/FYVE/PHD zinc finger superfamily protein, put... [more]
A0A061GYX1_THECC4.342e-13446.48RING/FYVE/PHD zinc finger superfamily protein, put... [more]
A5B054_VITVI4.186e-9532.82Putative uncharacterized protein OS=Vitis vinifera... [more]
D7THZ7_VITVI4.545e-9532.69Putative uncharacterized protein OS=Vitis vinifera... [more]
B9II56_POPTR1.620e-8531.24Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0005590 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 298..318
NoneNo IPR availablePANTHERPTHR21717:SF18HOMEODOMAIN-LIKE PROTEIN WITH RING/FYVE/PHD-TYPE ZINC FINGER DOMAINcoord: 421..694
NoneNo IPR availablePANTHERPTHR21717TELOMERIC REPEAT BINDING PROTEINcoord: 421..694
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 431..476
e-value: 3.8E-4
score: 29.8
IPR009057Homeodomain-likeGENE3D1.10.10.60coord: 637..694
e-value: 7.0E-12
score: 44.6
IPR009057Homeodomain-likeSUPERFAMILY46689Homeodomain-likecoord: 635..694
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 414..480
e-value: 3.9E-8
score: 32.2
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 432..475
IPR017877Myb-like domainPROSITEPS50090MYB_LIKEcoord: 633..693
score: 7.956
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILY57903FYVE/PHD zinc fingercoord: 419..480

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0005590 ID=g.arboreum_cottongen_reftransV1_0005590|Name=g.arboreum_cottongen_reftransV1_0005590|organism=Gossypium arboreum|type=contig|length=2426bp
AGAAAGAACACATTGTTTCCCGGCACTCAAGTGATACTCTTCTCTTTGAA
ATATTTCAATGGATTCTTAAGGTAAATCAAGTGCTTGCTCTTGACTTGGT
CCGATGTTTCGCCCTTACTCTTATGGTCCAAGAGCTGCATGGCTTTGGAT
CATTGAGTACGTATCAAGCTTTCCCCAGCTAGATATTTCCATTATATCCG
GTCTGATTGAAACAGCTCCAATTTTACCAGAGGACCTAGAAGAAAATACA
AGTGAAAGGGTTGCTTTAAGATGCTTGGAGGAGTTATTTGGTCCTCAAAA
CAGTCATGGAAGTGTTGCTCCCGTTTCAAGAGCTGTTTTGAATCCTTCTG
CAAGCTGCGATGATGTTCTTGATCACATACTGTATCACATACTGCAAAAG
GTCCCATTATCTGATCTGAAAAATGCTGGACCAGAGCTTTTGAGATGGGA
TGGTCACTCCTTTATTGAGCATAAAAGAGCCACCCTACCTAAATGTGCAT
TAGAACAGTTGAAAGATGTTATTTTGCTGGACGACCCTTATCTTGATGGC
AATGAAAATGGGCCTCCATCACGGTCTGATGACAGCAATGATGAAAATGG
TAATCAAGAGGGTAACTTGATTCCACAAATTAAAAAAAATGAAGAGTTGC
TTGGAAGAAATCCAATTCCGTCGAAGAGGTCTAGAGATGAGTTGGTTGCT
GGAAATTCGAAGGGAATAGTCAGTGTTAACCATGGTAGTATGCAATGTGA
TCTTCATTTGAATGCAAAGAAGTCAAAGCTAGTTGCGAAGCCCGCTTGTA
CTATTCAGGCTGTTGCGGAGCTTCCAATTCACCTGCATGATGATGATGAG
CGGTTGGAAGATGAATCTCAAAGGATTATGAAGGTTACTGAAATAGGGAC
TAATAACTTGGGAAAGGTTTCTCAGATAGGTGAGGGTAATCGAGATTTAT
GTGTTGCCTCAAGGACCCCTGGGCTGATTGATGCTGTTGGTCGTGTGGAA
TTGCTGGACAATCAGATGGAAAATGTTCAAAATGATAATACTGACATGAT
GGTCGAGCAAAAGCATGGAGATATAATTTGCCCAAATGTTGTGATTAACG
AATCCAGTCCTGTTGAAAATGGTGCACCGGTAAAGGAATCTAGTGGTGAT
GTGGGTGGAAATATTGATCACGATTTTACATCAAGTTCCCAAAATTCTAT
CTCCGCTGATGGGTTACAAGAAAATGTTGATCTGAATGGGGAAAAAGCTG
ACATGGATCATCCTTGTGTGGAACAGATATGCGAAGATGAAGATGAGATC
TTTAACATTTCCTTAAAGAAGAACCTTTTCTTGAGTTCACAGCACATGGC
TAGTCAAGATCCTGTTCAAAATGCTGACTGGACAGAACAAAATTCTTGTG
TCAAGTGTAATCAAAATGGTCGGTTGTTGGTCTGTACTTCTAGTGGTTGC
CTGCTTGCGGTTCATGAGAGCTGCTTGAATTGCCCTGCAAGATTTGATGA
TAAGGGCCACTTTCTTTGCCCTTTCTGTGCATGCTCTGTTTCCATCTCAA
ATTATCTAGAAGCTAAGAACAAGATCATCTTGGCAAGGAAGAAACTAGTT
GCATTTATGGGGCTTATGGGAAAACTTATTCAGGAGCAGGGGAGGTCTTG
GAATCATTCAAAATTAAATGGCAATGAAAACCTTGCTGGAATTCAGGAGA
GTGGGCATCTAGGGAGAGAGCATGAACACAAACAGGAAGAACTACCAGCC
AAGCTTAAAACCTCTGATGATAATCCAACCACTGAAAACACTGAAACTTT
CCCCATAAATCAGGTAGAAGTTGAAGGAGATGACATACTAAAGGAAGTTG
TAGGGCCTCAGATTACTGATGCAAGTCAGAAACTTGTCAATAGTGATGGA
GAGGAATCATCTACCAGTGCAGATGATAAGTATATAATATCTAGTCATTC
TACAAGGTCCAAAAAAAGTGAAACAAGGCAATCATTCTCGCCAACTCGAC
GATTGAGAAGAAAGAAAGCTCCATGGACGAATGACGAAGAAGAGATGCTC
AGGAAGGGAGTGCAGGAGCTTGCAAATGAGGATGGGACAGTTCCATGGAA
GAGAATTTTGGAGTTTGGTACCAATGTGTTTCTTATGGATAGGACTGCAA
CAGACCTCAAGAATAAGTGGAGAAGTATGTGCAAGGATAGCCCGGGATGC
AAATGATATGATGTCACAGCCTTGTGATTTTGCATATAAGATGATGTGAT
TTATATATCTCGGTTAAGTCATCTCTTTTTGTTTTAAAGGAAGTAGGTGA
GTTCAATAGCTCTGTTATGATTTACTGTATTCAGGGCTACAGCATAAGTA
ATAGGAAGTTGGAAATGGGTTTTCCCCCTGTTTTTGTCTTTTGTGAAATG
AAATACTTGTTTGGCTTTGATGGAAT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001965Znf_PHD
IPR009057Homeobox-like_sf
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR017877Myb-like_dom
IPR011011Znf_FYVE_PHD
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003677DNA binding