g.arboreum_cottongen_reftransV1_0017305, g.arboreum_cottongen_reftransV1_0017305 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0017305
Unique Nameg.arboreum_cottongen_reftransV1_0017305
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length321
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0017305:1..321 .
Chr5:58153386..58153955 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0B0N443_GOSAR (DUF21 domain-containing-like protein OS=Gossypium arboreum GN=F383_10455 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.690e-54
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  326 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 431          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2RF94_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G040600 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.504e-49
Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRG SKNASATVDGEKSEENN +SNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK +AATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  160 SSHMAAVVRGKSKNASATVDGEKSEENNSLSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK-NAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 264          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2R8U4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G040600 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 7.903e-49
Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRG SKNASATVDGEKSEENN +SNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK +AATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  246 SSHMAAVVRGKSKNASATVDGEKSEENNSLSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK-NAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 350          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2N7L7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G040600 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.046e-49
Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRG SKNASATVDGEKSEENN +SNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK +AATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  231 SSHMAAVVRGKSKNASATVDGEKSEENNSLSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK-NAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 335          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2PMG6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G040600 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.254e-48
Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRG SKNASATVDGEKSEENN +SNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK +AATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  326 SSHMAAVVRGKSKNASATVDGEKSEENNSLSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK-NAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 430          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2PMH0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G040600 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.466e-48
Identity = 101/106 (95.28%), Postives = 103/106 (97.17%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVVRG SKNASATVDGEKSEENN +SNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK +AATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  361 SSHMAAVVRGKSKNASATVDGEKSEENNSLSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCK-NAATNGPSMTSEDIEDGEVIGIITLEDVFEELLQEEIV 465          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A061ELF2_THECC (CBS domain-containing protein with a domain of Uncharacterized protein function isoform 2 OS=Theobroma cacao GN=TCM_020501 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.333e-23
Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASA--TVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPP-LCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVV+   KN     TVDG+K EEN    + A+SQLTTPLL K +EKPES+ VDIDK+ +P  L + DAATNG  +TSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  324 SSHMAAVVKAKGKNKILPPTVDGQKYEENK--VSLADSQLTTPLLSKLEEKPESIAVDIDKAPRPANLNRQDAATNGLPITSEDIEDGEVIGIITLEDVFEELLQEEIV 430          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A061EMA8_THECC (CBS domain-containing protein with a domain of Uncharacterized protein function isoform 1 OS=Theobroma cacao GN=TCM_020501 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.308e-23
Identity = 77/109 (70.64%), Postives = 87/109 (79.82%), Query Frame = -2
Query:    3 SSHMAAVVRGNSKNASA--TVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPP-LCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVV+   KN     TVDG+K EEN +VS  A+SQLTTPLL K +EKPES+ VDIDK+ +P  L + DAATNG  +TSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  458 SSHMAAVVKAKGKNKILPPTVDGQKYEEN-KVS-LADSQLTTPLLSKLEEKPESIAVDIDKAPRPANLNRQDAATNGLPITSEDIEDGEVIGIITLEDVFEELLQEEIV 564          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2VN89_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G170300 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 7.414e-23
Identity = 75/109 (68.81%), Postives = 86/109 (78.90%), Query Frame = -2
Query:    3 SSHMAAVVR--GNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPP-LCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVV+  G +KN   TVDG KSEEN +VS +A++QLTTPLL K DEKPES+ VD+ K  +P    + DA T G S+TSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  215 SSHMAAVVKAKGKNKNLPLTVDGLKSEEN-KVS-SADTQLTTPLLSKLDEKPESIVVDVGKLSRPTNTSRLDAVTYGLSVTSEDIEDGEVIGIITLEDVFEELLQEEIV 321          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Match: A0A0D2UU91_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G170300 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.327e-22
Identity = 75/109 (68.81%), Postives = 86/109 (78.90%), Query Frame = -2
Query:    3 SSHMAAVVR--GNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPP-LCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAVV+  G +KN   TVDG KSEEN +VS+A ++QLTTPLL K DEKPES+ VD+ K  +P    + DA T G S+TSEDIEDGEVIGIITLEDVFEELLQEEIV
Sbjct:  321 SSHMAAVVKAKGKNKNLPLTVDGLKSEEN-KVSSA-DTQLTTPLLSKLDEKPESIVVDVGKLSRPTNTSRLDAVTYGLSVTSEDIEDGEVIGIITLEDVFEELLQEEIV 427          
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy Swiss-Prot
Match: Y4423_ARATH (DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.996e-13
Identity = 61/108 (56.48%), Postives = 73/108 (67.59%), Query Frame = -2
Query:    3 SSHMAAV--VRGNSKNASATVDGEKSEENNRVSNAAESQLTTPLLPKQDEKPESVTVDIDKSFKPPLCKYDAATNGPSMTSXXXXXXXXXXXITLEDVFEELLQEEIV 320
            SSHMAAV  V+G SK   +T+  E S E+N  SN   S+LT PLL K++   +SV V IDK+        +A   G S TSE+IEDG+VIGIITLEDVFEELLQEEIV
Sbjct:  320 SSHMAAVVKVKGKSKGHPSTLHEENSGESNVSSN--NSELTAPLLLKREGNHDSVIVRIDKANGQSFIS-EAGRQGFSHTSEEIEDGDVIGIITLEDVFEELLQEEIV 424          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0N443_GOSAR1.690e-54100.00DUF21 domain-containing-like protein OS=Gossypium ... [more]
A0A0D2RF94_GOSRA2.504e-4995.28Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2R8U4_GOSRA7.903e-4995.28Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2N7L7_GOSRA8.046e-4995.28Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PMG6_GOSRA2.254e-4895.28Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PMH0_GOSRA3.466e-4895.28Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061ELF2_THECC2.333e-2368.81CBS domain-containing protein with a domain of Unc... [more]
A0A061EMA8_THECC5.308e-2370.64CBS domain-containing protein with a domain of Unc... [more]
A0A0D2VN89_GOSRA7.414e-2368.81Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2UU91_GOSRA1.327e-2268.81Uncharacterized protein OS=Gossypium raimondii GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0017305 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4423_ARATH3.996e-1356.48DUF21 domain-containing protein At4g14230 OS=Arabi... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12064:SF32SUBFAMILY NOT NAMEDcoord: 1..10
NoneNo IPR availablePANTHERPTHR12064ANCIENT CONSERVED DOMAIN PROTEIN-RELATEDcoord: 1..10
NoneNo IPR availablePANTHERPTHR12064ANCIENT CONSERVED DOMAIN PROTEIN-RELATEDcoord: 75..103
NoneNo IPR availablePANTHERPTHR12064:SF32SUBFAMILY NOT NAMEDcoord: 75..103

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0017305 ID=g.arboreum_cottongen_reftransV1_0017305|Name=g.arboreum_cottongen_reftransV1_0017305|organism=Gossypium arboreum|type=contig|length=321bp
TCCACTATCTCCTCCTGTAGAAGTTCTTCAAAAACATCTTCTAGGGTGAT
AATACCAATAACTTCACCATCTTCAATATCCTCTGATGTCATAGACGGTC
CATTTGTTGCAGCATCATACTTGCATAAAGGAGGCTTGAAAGACTTGTCA
ATGTCAACAGTTACGGACTCTGGCTTCTCGTCTTGTTTGGGAAGCAAAGG
AGTAGTCAGTTGGGATTCTGCTGCATTGGAGACTCTATTGTTTTCTTCAC
TTTTTTCTCCATCAACTGTAGCAGAAGCATTCTTAGAGTTGCCTCTAACA
ACAGCTGCCATATGACTGCTG
back to top