g.arboreum_cottongen_reftransV1_0012136, g.arboreum_cottongen_reftransV1_0012136 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0012136
Unique Nameg.arboreum_cottongen_reftransV1_0012136
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length578
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr8chromosomeg.arboreum_cottongen_reftransV1_0012136:16..578 .
Chr8:94953844..94954982 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0B0PNX6_GOSAR (Pre-mRNA-processing factor 40 A OS=Gossypium arboreum GN=F383_10570 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.228e-96
Identity = 192/192 (100.00%), Postives = 192/192 (100.00%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVTGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  233 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVTGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 424          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2R0V6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.521e-95
Identity = 187/192 (97.40%), Postives = 190/192 (98.96%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  210 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 401          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2V4N8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.660e-94
Identity = 187/192 (97.40%), Postives = 190/192 (98.96%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  210 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 401          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2V4N5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 8.817e-94
Identity = 187/192 (97.40%), Postives = 190/192 (98.96%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  210 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 401          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2SLJ2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 4.035e-93
Identity = 187/192 (97.40%), Postives = 190/192 (98.96%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  210 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 401          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2U4X1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 6.560e-93
Identity = 187/192 (97.40%), Postives = 190/192 (98.96%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  252 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 443          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2U4W8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.720e-91
Identity = 182/187 (97.33%), Postives = 185/187 (98.93%), Query Frame = 3
Query:   18 RADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            RADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVTRSSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:   33 RADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVTRSSETTATQDTMHFADGASAQDIEEAKKGMATA 219          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A0D2U7V5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G027200 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.360e-90
Identity = 186/192 (96.88%), Postives = 189/192 (98.44%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAA+SQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSV+GPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTV APSVGA TAVT SSETT+TQDTMHFADGASAQDIEEAKKGMATA
Sbjct:  210 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAASSQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTPVANPSPTSVSGPTTGPVAQSAAMSATGVQLPVVSVTPVPAVPSRGSTVSAPSVGATTAVT-SSETTATQDTMHFADGASAQDIEEAKKGMATA 400          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A061FFM2_THECC (Pre-mRNA-processing protein 40A isoform 8 OS=Theobroma cacao GN=TCM_034659 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.653e-67
Identity = 146/195 (74.87%), Postives = 163/195 (83.59%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTP---VANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYY+NKVTK+SKWTIPEELKLAREQAQ  ASQG PS +GVA QAPVA AVS+AE P  AIPVSSNT Q SSPVSVTP   VANPSPT V+G T  PV+QSAA +A+ VQ P V+VTP+PAV S GST P  SV ANT + RS E+T++QD++HF +GASAQDIEEAKKGMATA
Sbjct:  255 MTPIERADASTVWKEFTTPEGRKYYYNKVTKQSKWTIPEELKLAREQAQVVASQGAPSDTGVASQAPVAGAVSSAEMPAAAIPVSSNTSQASSPVSVTPVAAVANPSPTLVSGSTVVPVSQSAATNASEVQSPAVAVTPLPAVSSGGSTTPVTSVNANTTMIRSLESTASQDSVHFTNGASAQDIEEAKKGMATA 449          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Match: A0A061FG73_THECC (Pre-mRNA-processing protein 40A isoform 7 OS=Theobroma cacao GN=TCM_034659 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.806e-67
Identity = 146/195 (74.87%), Postives = 163/195 (83.59%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIPVSSNTLQDSSPVSVTP---VANXXXXXXXXXXXXXXAQSAAMSATGVQLXXXXXXXXXXXXXRGSTVPAPSVGANTAVTRSSETTSTQDTMHFADGASAQDIEEAKKGMATA 578
            MTPIERADASTVWKEFTTPEGRKYY+NKVTK+SKWTIPEELKLAREQAQ  ASQG PS +GVA QAPVA AVS+AE P  AIPVSSNT Q SSPVSVTP   VANPSPT V+G T  PV+QSAA +A+ VQ P V+VTP+PAV S GST P  SV ANT + RS E+T++QD++HF +GASAQDIEEAKKGMATA
Sbjct:  255 MTPIERADASTVWKEFTTPEGRKYYYNKVTKQSKWTIPEELKLAREQAQVVASQGAPSDTGVASQAPVAGAVSSAEMPAAAIPVSSNTSQASSPVSVTPVAAVANPSPTLVSGSTVVPVSQSAATNASEVQSPAVAVTPLPAVSSGGSTTPVTSVNANTTMIRSLESTASQDSVHFTNGASAQDIEEAKKGMATA 449          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy Swiss-Prot
Match: PR40A_ARATH (Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.023e-27
Identity = 60/99 (60.61%), Postives = 75/99 (75.76%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVS--AAETPTTAIPVSSNTL--QDSSPV 287
            MTP+ERADASTVWKEFTTPEG+KYY+NKVTKESKWTIPE+LKLAREQAQ A+ + + S +G  P +  A + S  A  T T+ +P +S+ L    SSP+
Sbjct:  219 MTPLERADASTVWKEFTTPEGKKYYYNKVTKESKWTIPEDLKLAREQAQLASEKTSLSEAGSTPLSHHAASSSDLAVSTVTSVVPSTSSALTGHSSSPI 317          
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy Swiss-Prot
Match: PR35B_ARATH (Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 8.082e-19
Identity = 43/83 (51.81%), Postives = 59/83 (71.08%), Query Frame = 3
Query:    3 MTPIERADASTVWKEFTTPEGRKYYHNKVTKESKWTIPEELKLAREQAQAAASQGTPSGSGVAPQAPVATAVSAAETPTTAIP 251
            MT  ERADA T WKE ++P+GRKYY+NK+TK+S WT+PEE+K+ REQA+ A+ QG P   G+   + V T    ++T +TA P
Sbjct:  238 MTLFERADARTDWKEHSSPDGRKYYYNKITKQSTWTMPEEMKIVREQAEIASVQG-PHAEGIIDASEVLT---RSDTASTAAP 316          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PNX6_GOSAR2.228e-96100.00Pre-mRNA-processing factor 40 A OS=Gossypium arbor... [more]
A0A0D2R0V6_GOSRA2.521e-9597.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V4N8_GOSRA2.660e-9497.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2V4N5_GOSRA8.817e-9497.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SLJ2_GOSRA4.035e-9397.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2U4X1_GOSRA6.560e-9397.40Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2U4W8_GOSRA2.720e-9197.33Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2U7V5_GOSRA1.360e-9096.88Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FFM2_THECC3.653e-6774.87Pre-mRNA-processing protein 40A isoform 8 OS=Theob... [more]
A0A061FG73_THECC3.806e-6774.87Pre-mRNA-processing protein 40A isoform 7 OS=Theob... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0012136 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PR40A_ARATH4.023e-2760.61Pre-mRNA-processing protein 40A OS=Arabidopsis tha... [more]
PR35B_ARATH8.082e-1951.81Pre-mRNA-processing protein 40B OS=Arabidopsis tha... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001202WW domainSMARTSM00456ww_5coord: 8..40
e-value: 3.0E-7
score: 40.1
IPR001202WW domainPFAMPF00397WWcoord: 13..38
e-value: 1.7E-8
score: 34.1
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 7..40
score: 12.393
IPR001202WW domainSUPERFAMILY51045WW domaincoord: 12..46
NoneNo IPR availableGENE3D2.20.70.10coord: 13..42
e-value: 1.2E-15
score: 56.1
NoneNo IPR availablePANTHERPTHR11864:SF21SUBFAMILY NOT NAMEDcoord: 1..50
NoneNo IPR availablePANTHERPTHR11864:SF21SUBFAMILY NOT NAMEDcoord: 129..187
NoneNo IPR availablePANTHERPTHR11864PRE-MRNA-PROCESSING PROTEIN PRP40coord: 1..50
NoneNo IPR availablePANTHERPTHR11864PRE-MRNA-PROCESSING PROTEIN PRP40coord: 129..187

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0012136 ID=g.arboreum_cottongen_reftransV1_0012136|Name=g.arboreum_cottongen_reftransV1_0012136|organism=Gossypium arboreum|type=contig|length=578bp
TGATGACACCAATAGAGAGAGCTGATGCATCCACTGTTTGGAAGGAATTT
ACAACTCCAGAGGGGAGAAAGTATTACCACAACAAGGTTACAAAGGAGTC
TAAGTGGACAATACCTGAGGAGTTGAAGTTAGCTCGTGAGCAAGCTCAAG
CAGCAGCTAGCCAAGGAACCCCATCAGGTTCAGGAGTGGCTCCTCAAGCT
CCAGTTGCTACTGCTGTCTCTGCAGCTGAGACACCTACTACAGCTATTCC
TGTGAGCTCCAACACTTTGCAGGATTCAAGCCCAGTTTCAGTTACGCCTG
TTGCTAATCCTTCACCTACTTCAGTAACTGGACCAACAACAGGTCCTGTT
GCACAATCAGCTGCTATGAGTGCAACTGGGGTTCAACTCCCTGTTGTGTC
TGTGACACCTGTACCTGCAGTCCCCTCCAGAGGTTCCACTGTCCCTGCTC
CTTCTGTTGGTGCTAACACAGCAGTCACAAGAAGCTCAGAAACTACATCA
ACTCAAGACACTATGCATTTTGCAGATGGAGCTTCTGCTCAGGACATTGA
GGAAGCTAAAAAGGGGATGGCAACGGCT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001202WW_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding