g.arboreum_cottongen_reftransV1_0006769, g.arboreum_cottongen_reftransV1_0006769 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0006769
Unique Nameg.arboreum_cottongen_reftransV1_0006769
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length966
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0006769:1..966 .
Chr5:8027116..8029419 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A0D2SN24_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G247400 PE=4 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 3.212e-169
Identity = 288/293 (98.29%), Postives = 290/293 (98.98%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL IASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIF ISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMLLKSLIIIGAILGLILGIVGTAVPWLFPNIFT DQKVIDEMHKVLAPYFISLAVTPAAL+LEGTLLAGHDLKFVSLMMSGCFTLGAIVLLLVSSGGFGLPGCWYAL+GFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA
Sbjct:  104 WGPLKALAIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFTISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMLLKSLIIIGAILGLILGIVGTAVPWLFPNIFTADQKVIDEMHKVLAPYFISLAVTPAALSLEGTLLAGHDLKFVSLMMSGCFTLGAIVLLLVSSGGFGLPGCWYALIGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 396          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A0D2NI25_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G247500 PE=4 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 8.955e-143
Identity = 245/293 (83.62%), Postives = 269/293 (91.81%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASA+NG+GDIVLCSFLGYGIAGAAWATMVSQVVAGYMMI SLNKKG+NA+ IS+PSLDDL+TI  ++APVFI MMAKVAFYALIIYFATNMGT+T AAHQVMIQTY M TVWGEPLSQTAQSFMPELLYGIN+NL KAR LLKSL+IIGA LGLILGIVGT+VPWLFPNIFT D+KVI EMH+VLAPYF++LAVTPA  +LEGTLLAG DLKFVSL MSGCF+LGA+VLLLVSSGG+GL GCWYAL+GFQWARFFL LQRLLSPTG+L+ EESND KPE LK A
Sbjct:  104 WGPLKALAVASAVNGIGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMITSLNKKGYNAYTISIPSLDDLQTISGLAAPVFIMMMAKVAFYALIIYFATNMGTHTAAAHQVMIQTYCMCTVWGEPLSQTAQSFMPELLYGINKNLPKARTLLKSLVIIGASLGLILGIVGTSVPWLFPNIFTSDRKVIHEMHRVLAPYFVALAVTPATHSLEGTLLAGRDLKFVSLSMSGCFSLGAVVLLLVSSGGYGLSGCWYALLGFQWARFFLSLQRLLSPTGILHYEESNDCKPEKLKAA 396          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A0D2RSZ4_GOSRA (MATE efflux family protein OS=Gossypium raimondii GN=B456_005G247500 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 1.098e-139
Identity = 245/293 (83.62%), Postives = 269/293 (91.81%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASA+NG+GDIVLCSFLGYGIAGAAWATMVSQVVAGYMMI SLNKKG+NA+ IS+PSLDDL+TI  ++APVFI MMAKVAFYALIIYFATNMGT+T AAHQVMIQTY M TVWGEPLSQTAQSFMPELLYGIN+NL KAR LLKSL+IIGA LGLILGIVGT+VPWLFPNIFT D+KVI EMH+VLAPYF++LAVTPA  +LEGTLLAG DLKFVSL MSGCF+LGA+VLLLVSSGG+GL GCWYAL+GFQWARFFL LQRLLSPTG+L+ EESND KPE LK A
Sbjct:  249 WGPLKALAVASAVNGIGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMITSLNKKGYNAYTISIPSLDDLQTISGLAAPVFIMMMAKVAFYALIIYFATNMGTHTAAAHQVMIQTYCMCTVWGEPLSQTAQSFMPELLYGINKNLPKARTLLKSLVIIGASLGLILGIVGTSVPWLFPNIFTSDRKVIHEMHRVLAPYFVALAVTPATHSLEGTLLAGRDLKFVSLSMSGCFSLGAVVLLLVSSGGYGLSGCWYALLGFQWARFFLSLQRLLSPTGILHYEESNDCKPEKLKAA 541          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A061E0M3_THECC (MATE efflux family protein OS=Theobroma cacao GN=TCM_006803 PE=3 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 3.608e-132
Identity = 235/293 (80.20%), Postives = 263/293 (89.76%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASAING+GDIV CS LGYGIAGAAWATMVSQ+VA YMMI+SLNKKG+NAFAIS+PS +DL TIF ++APVF+ MMAKVAFYAL+IYFATNMGT+TVAAHQVMIQTY M TVWGEPLSQTAQSFMPELLYGIN++L KARMLLKSL+IIGA LGL+LGIVGT+VPWLFPNIFT DQKV+ EMHKVLAPYFI+LAVTPA  +LEGTLL   DLKFVSL MSGCF+LGA+VLLL+SSGG+GLPGCWY L+GFQWARFFL LQRLLS  G+L SE+ N Y+ E LK A
Sbjct:  260 WGPLKALAVASAINGIGDIVSCSLLGYGIAGAAWATMVSQIVAAYMMINSLNKKGYNAFAISIPSPNDLLTIFGLAAPVFVMMMAKVAFYALLIYFATNMGTHTVAAHQVMIQTYCMCTVWGEPLSQTAQSFMPELLYGINKSLPKARMLLKSLVIIGASLGLLLGIVGTSVPWLFPNIFTSDQKVVQEMHKVLAPYFIALAVTPATHSLEGTLLGRRDLKFVSLSMSGCFSLGAVVLLLLSSGGYGLPGCWYTLLGFQWARFFLSLQRLLSAHGILDSEDLNKYRQENLKAA 552          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A0B0N3P9_GOSAR (MATE efflux family protein 4, chloroplastic OS=Gossypium arboreum GN=F383_15228 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 4.145e-131
Identity = 256/304 (84.21%), Postives = 256/304 (84.21%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXX-----------XGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQ                                     ARMLLKSLIIIGAILGLILGIVGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPAALALEGTLL           AGHDLKFVSLMMSGCFTLGAIVLLLVSSGGFGLPGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA
Sbjct:   90 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQ-------------------------------------ARMLLKSLIIIGAILGLILGIVGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPAALALEGTLLCRLCSLSRPLQAGHDLKFVSLMMSGCFTLGAIVLLLVSSGGFGLPGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 356          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: B9RHB8_RICCO (MATE efflux family protein OS=Ricinus communis GN=RCOM_1449560 PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 2.206e-127
Identity = 214/291 (73.54%), Postives = 259/291 (89.00%), Query Frame = -2
Query:   93 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLK 965
            WGPLKAL ++S +NGVGD+VLCSF+GYGIAGAAWATMVSQV+A YMMI++LNKKG+NAFA+++P+LD+L +I  I+APVFITMM+KVAFY+L+IYFAT+MGT++VAAHQVMIQTY M TVWGEPLSQTAQSFMPELLYG NR+L+KAR LLKSL+IIGA LGL+LG +GT+VPWLFPN+FTPDQ +I EMHKVL PY ++LAVTP+  +LEGTL+AG DLKF+SL M+GCF  G +VL+L+ S G+GL GCWYALVGFQW+RFFL LQRLLSP G+LYSE+ + YK E LK
Sbjct:  260 WGPLKALAVSSIVNGVGDVVLCSFMGYGIAGAAWATMVSQVIAAYMMIEALNKKGYNAFAVTIPTLDELLSIVGIAAPVFITMMSKVAFYSLLIYFATSMGTHSVAAHQVMIQTYSMCTVWGEPLSQTAQSFMPELLYGANRSLAKARTLLKSLVIIGATLGLVLGTIGTSVPWLFPNLFTPDQNIIQEMHKVLLPYIMALAVTPSTHSLEGTLMAGRDLKFLSLSMTGCFAFGGLVLMLICSRGYGLAGCWYALVGFQWSRFFLALQRLLSPDGVLYSEDLSRYKIEKLK 550          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A061E0M0_THECC (MATE efflux family protein OS=Theobroma cacao GN=TCM_006799 PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 2.431e-123
Identity = 214/293 (73.04%), Postives = 259/293 (88.40%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASAING+GD+VLC FLGYGIAGAAWATMVSQVVA YMMI++LNKKG+NAF+IS+PSL++L  +  ++APVF+TMM+KVAFY+L+IYFAT+MGT+TVAAHQVM+QT  M TVWGEP+SQ+AQSFMPEL+ G+NRNLSKAR+LLKSL+ IGA LGL+LGI+GTAVP  FPNIFTPD KVI EMHKVL PYF++LAVTP+  +LEGTLLAG +L+F+SL MSGCF  GA++LLLVS+ G+GLPGCW+ALVGFQWARF L LQRLLSP G+LYSE+   Y+ + L+ A
Sbjct:  266 WGPLKALAVASAINGIGDVVLCIFLGYGIAGAAWATMVSQVVAAYMMIEALNKKGYNAFSISIPSLNELLAVLTLAAPVFVTMMSKVAFYSLLIYFATSMGTHTVAAHQVMLQTLSMCTVWGEPISQSAQSFMPELICGVNRNLSKARVLLKSLVTIGATLGLVLGIIGTAVPCFFPNIFTPDPKVIQEMHKVLLPYFLALAVTPSTHSLEGTLLAGRELRFISLSMSGCFAFGALILLLVSTRGYGLPGCWFALVGFQWARFSLSLQRLLSPNGILYSEDLRQYEVKKLRAA 558          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: M5VVP0_PRUPE (MATE efflux family protein OS=Prunus persica GN=PRUPE_ppa003694mg PE=3 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 4.076e-123
Identity = 216/291 (74.23%), Postives = 258/291 (88.66%), Query Frame = -2
Query:   93 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLK 965
            WGPLKAL +ASAIN VGD++LCSFLGYGIAGAAWATMVSQVVAGYMMI++LN KG+N +AISVPS  +L T+  ++APVF+TMM+KVAFY+L++YFAT+MGT T+AAHQVMIQT+ M TVWGEPLSQTAQSFMPE +YG+NR+L+KARMLLKSL+IIGAILG +LGI+GT VPWLFPNIFTPDQK+I EMHKVL PYF++LAVTP   +LEGTLLAG DLKF+SL MSGCF+LG ++LLL+SS G+GL GCW+ALV FQW RFFL LQRL+SP GML+SE+ + YK E L+
Sbjct:  263 WGPLKALAVASAINAVGDVLLCSFLGYGIAGAAWATMVSQVVAGYMMIEALNNKGYNGYAISVPSSKELLTVLGLAAPVFVTMMSKVAFYSLLVYFATSMGTNTMAAHQVMIQTFCMCTVWGEPLSQTAQSFMPEFIYGVNRSLAKARMLLKSLVIIGAILGSVLGIIGTCVPWLFPNIFTPDQKIIQEMHKVLIPYFLALAVTPPTHSLEGTLLAGRDLKFISLSMSGCFSLGGLLLLLLSSRGYGLAGCWWALVAFQWTRFFLSLQRLISPDGMLFSEDMSRYKLEKLR 553          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: W9SBB5_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_008440 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.383e-122
Identity = 210/291 (72.16%), Postives = 247/291 (84.88%), Query Frame = -2
Query:   93 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLK 965
            WGPLKAL  AS INGVGDI LC FLGYGIAGAAWATMVSQVVA YMMI++LNKKG+NA+AIS+PS  +L  I A++APVF+TMMAKVAFY +++YFAT++GT T+AAHQVMIQT+ M TVWGEPLSQTAQSFMPELLYG+ R+L KARMLLKSL+IIG I+GL+LGIVGT++PWLFP IFT DQ VI EMHK+L PYF++L+VTP   +LEGTLLAG DLKF+S+ MSGCFT GA++L + SS GFGL GCW AL  FQW RFFL LQRLLSP G+LY E+S+  + E LK
Sbjct:    5 WGPLKALAAASVINGVGDIALCIFLGYGIAGAAWATMVSQVVAAYMMIEALNKKGYNAYAISIPSPKELLDIVALAAPVFVTMMAKVAFYTILVYFATSLGTITMAAHQVMIQTFCMCTVWGEPLSQTAQSFMPELLYGVKRSLEKARMLLKSLVIIGVIVGLVLGIVGTSIPWLFPKIFTRDQMVIQEMHKILVPYFLALSVTPPTHSLEGTLLAGRDLKFISMSMSGCFTFGALLLTIASSKGFGLAGCWSALAVFQWTRFFLALQRLLSPEGILYREDSSSDELEKLK 295          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Match: A0A067DM18_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0086951mg PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 1.334e-121
Identity = 215/294 (73.13%), Postives = 251/294 (85.37%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSK-ARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASA+NG+GDIVLC FLGYGIAGAAWATM SQV+A YMMI +LN+KG+NAFAIS+P   +L  IF ++APVF+ MM+KVAF+ L+ YFAT+MGT T+AAHQVMIQT  M TVWGEPL+QTAQSFMPE LYG+NRNL+K ARMLLKSL+IIGAILG++L IVGT+VPWLFPNIFTPD+ +I EMHKVL  YF++L VTPA L+LEGTLLAG DLKFVS  MSGCF+LGA+ LLLVS  G+GLPGCWY LVGFQW RFFL  QRLLSPTG+LYSE  + ++ E LK A
Sbjct:   26 WGPLKALVVASAVNGIGDIVLCRFLGYGIAGAAWATMASQVIAAYMMIINLNQKGYNAFAISIPLPSELLAIFELAAPVFVMMMSKVAFFTLLTYFATSMGTITLAAHQVMIQTLMMCTVWGEPLAQTAQSFMPEFLYGMNRNLAKLARMLLKSLVIIGAILGVLLAIVGTSVPWLFPNIFTPDKVIIQEMHKVLVAYFVALIVTPAILSLEGTLLAGRDLKFVSFSMSGCFSLGALALLLVSGKGYGLPGCWYVLVGFQWTRFFLAFQRLLSPTGILYSENVSKHQLEKLKAA 319          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy Swiss-Prot
Match: MATE4_ARATH (MATE efflux family protein 4, chloroplastic OS=Arabidopsis thaliana GN=DTX46 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.521e-115
Identity = 203/293 (69.28%), Postives = 250/293 (85.32%), Query Frame = -2
Query:   87 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLKVA 965
            WGPLKAL +ASAINGVGD+VLC+FLGYGIAGAAWATMVSQVVA YMM+D+LNKKG++AF+  VPS  +L TIF ++APVFITMM+KV FY L++YFAT+MGT  +AAHQVM+Q Y M TVWGEPLSQTAQSFMPELL+GINRNL KAR+LLKSL+IIGA LG+++G +GTAVPWLFP IFT D+ V  EMHKV+ PYF++L++TP+  +LEGTLLAG DL+++SL M+GC  +  ++L+L+S+GGFGL GCWYALVGFQWARF L L RLLS  G+LYSE+++ Y  E +K A
Sbjct:  268 WGPLKALAVASAINGVGDVVLCTFLGYGIAGAAWATMVSQVVAAYMMMDALNKKGYSAFSFCVPSPSELLTIFGLAAPVFITMMSKVLFYTLLVYFATSMGTNIIAAHQVMLQIYTMSTVWGEPLSQTAQSFMPELLFGINRNLPKARVLLKSLVIIGATLGIVVGTIGTAVPWLFPGIFTRDKVVTSEMHKVIIPYFLALSITPSTHSLEGTLLAGRDLRYISLSMTGCLAVAGLLLMLLSNGGFGLRGCWYALVGFQWARFSLSLFRLLSRDGVLYSEDTSRYA-EKVKAA 559          
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy Swiss-Prot
Match: EDS5_ARATH (Enhanced disease susceptibility 5 OS=Arabidopsis thaliana GN=EDS5 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.319e-92
Identity = 179/291 (61.51%), Postives = 231/291 (79.38%), Query Frame = -2
Query:   93 WGPLKALGIASAINGVGDIVLCSFLGYGIAGAAWATMVSQVVAGYMMIDSLNKKGFNAFAISVPSLDDLRTIFAISAPVFITMMAKVAFYALIIYFATNMGTYTVAAHQVMIQTYWMWTVWGEPLSQTAQSFMPELLYGINRNLSKARMXXXXXXXXXXXXXXXXXXXGTAVPWLFPNIFTPDQKVIDEMHKVLAPYFISLAVTPXXXXXXXXXXXGHDLKFVSLMMSGCFTLGAIXXXXXXXXXXXXXGCWYALVGFQWARFFLCLQRLLSPTGMLYSEESNDYKPEMLK 965
            WGPLKAL  A+ ING+GD +LC FLG GIAGAAWAT  SQ+V+ YMM+DSLNK+G+NA++ ++PS  +L  I A++APVFI++ +K+AFY+ IIY AT+MGT+ +AAHQVM QTY M  VWGEPLSQTAQSFMPE+LYG NRNL KAR LLKSL+IIGA LGL+LG++GTAVP LFP ++T D+ +I EMH++L P+F++L+  P  ++LEGTLLAG DLKFVS +MS  F +G + L+ V+  G+GL GCW+ LVGFQW RF L L+RLLSP G+L S+  + Y  E +K
Sbjct:  251 WGPLKALAAATIINGLGDTILCLFLGQGIAGAAWATTASQIVSAYMMMDSLNKEGYNAYSFAIPSPQELWKISALAAPVFISIFSKIAFYSFIIYCATSMGTHVLAAHQVMAQTYRMCNVWGEPLSQTAQSFMPEMLYGANRNLPKARTLLKSLMIIGATLGLVLGVIGTAVPGLFPGVYTHDKVIISEMHRLLIPFFMALSALPMTVSLEGTLLAGRDLKFVSSVMSSSFIIGCLTLMFVTRSGYGLLGCWFVLVGFQWGRFGLYLRRLLSPGGILNSDGPSPYTVEKIK 541          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2SN24_GOSRA3.212e-16998.29Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2NI25_GOSRA8.955e-14383.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RSZ4_GOSRA1.098e-13983.62MATE efflux family protein OS=Gossypium raimondii ... [more]
A0A061E0M3_THECC3.608e-13280.20MATE efflux family protein OS=Theobroma cacao GN=T... [more]
A0A0B0N3P9_GOSAR4.145e-13184.21MATE efflux family protein 4, chloroplastic OS=Gos... [more]
B9RHB8_RICCO2.206e-12773.54MATE efflux family protein OS=Ricinus communis GN=... [more]
A0A061E0M0_THECC2.431e-12373.04MATE efflux family protein OS=Theobroma cacao GN=T... [more]
M5VVP0_PRUPE4.076e-12374.23MATE efflux family protein OS=Prunus persica GN=PR... [more]
W9SBB5_9ROSA1.383e-12272.16Uncharacterized protein OS=Morus notabilis GN=L484... [more]
A0A067DM18_CITSI1.334e-12173.13Uncharacterized protein (Fragment) OS=Citrus sinen... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0006769 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
MATE4_ARATH2.521e-11569.28MATE efflux family protein 4, chloroplastic OS=Ara... [more]
EDS5_ARATH2.319e-9261.51Enhanced disease susceptibility 5 OS=Arabidopsis t... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002528Multi antimicrobial extrusion proteinPFAMPF01554MatEcoord: 75..234
e-value: 6.8E-7
score: 28.9
NoneNo IPR availablePANTHERPTHR11206:SF116ENHANCED DISEASE SUSCEPTIBILITY 5-RELATEDcoord: 1..289
NoneNo IPR availablePANTHERPTHR11206MULTIDRUG RESISTANCE PROTEINcoord: 1..289
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 69..94
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 269..290
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 46..68
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 174..192
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 244..248
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 249..268
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 193..212
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 21..45
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 151..173
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 213..218
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..20
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 95..150
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 219..243
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 219..241
NoneNo IPR availableTMHMMTMhelixcoord: 148..170

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0006769 ID=g.arboreum_cottongen_reftransV1_0006769|Name=g.arboreum_cottongen_reftransV1_0006769|organism=Gossypium arboreum|type=contig|length=966bp
ATTAATGAAAAGAATCATATAAGCAGCCAATATTAAAGCACAGGCTGAGA
TTGCAGTGATTCAATGTCTTTGCAAATGGTATACTAAGCAACTTTTAGCA
TCTCGGGTTTATAATCGTTCGATTCTTCAGAATAAAGCATGCCGGTAGGT
GAAAGGAGGCGTTGTAGACAAAGAAAAAACCGAGCCCATTGAAATCCTAC
GAGGGCATACCAGCAGCCCGGCAAACCGAATCCACCACTGCTCACCAGCA
GTAGTACAATAGCACCCAACGTGAAGCATCCACTCATCATTAAGCTAACG
AATTTAAGATCATGCCCTGCCAACAATGTTCCTTCAAGGGCGAGAGCAGC
TGGTGTCACGGCTAGTGAGATAAAGTACGGTGCCAACACTTTGTGCATCT
CGTCTATGACCTTCTGGTCGGGTGTGAAGATATTGGGAAATAACCAAGGA
ACTGCTGTTCCGACTATACCCAATATCAGTCCAAGGATAGCTCCGATGAT
GATAAGTGACTTTAGCAGCATTCGAGCCTTTGACAAATTTCTATTGATTC
CATATAGCAATTCTGGCATAAACGACTGTGCGGTTTGGGATAGAGGCTCG
CCCCATACGGTCCACATCCAATAGGTTTGGATCATGACCTGATGAGCAGC
CACCGTGTACGTGCCCATATTCGTCGCAAAATAGATGATGAGTGCATAGA
AAGCAACCTTTGCCATCATCGTTATGAAAACCGGGGCAGAGATTGCGAAA
ATCGTCCTAAGGTCATCGAGGGACGGAACCGAGATTGCAAATGCATTAAA
TCCTTTCTTGTTTAAAGAATCAATCATCATGTAACCAGCAACAACTTGTG
ACACCATTGTTGCCCAAGCAGCACCAGCTATGCCATAGCCTAAGAAGCTG
CAAAGTACTATATCTCCAACTCCATTTATAGCACTAGCAATACCTAAGGC
CTTCAAAGGTCCCCAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002528MATE_fam
Vocabulary: Molecular Function
TermDefinition
GO:0015297antiporter activity
GO:0015238drug transmembrane transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
GO:0006855drug transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane