g.arboreum_cottongen_reftransV1_0016082, g.arboreum_cottongen_reftransV1_0016082 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0016082
Unique Nameg.arboreum_cottongen_reftransV1_0016082
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length845
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0016082:1..845 .
Chr12:1516130..1517423 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A0B0MM60_GOSAR (Proline-rich receptor-like protein kinase PERK1 OS=Gossypium arboreum GN=F383_10410 PE=4 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 4.709e-179
Identity = 250/250 (100.00%), Postives = 250/250 (100.00%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR
Sbjct:  361 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 610          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A0D2VGR1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G012100 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 3.209e-178
Identity = 249/250 (99.60%), Postives = 250/250 (100.00%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRW+DRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR
Sbjct:  375 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWRDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 624          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A061GHZ8_THECC (Chitin elicitor receptor kinase 1, RLK1 OS=Theobroma cacao GN=TCM_030291 PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 4.586e-161
Identity = 226/251 (90.04%), Postives = 242/251 (96.41%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQ-DRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            H NLVRLIGYCVEGSLFLVYEFIENGNLSQHLR Q +RDPLPW ARVQI LDSARGLEYIHEHTVP+Y+HRDIKSANILIDKNFRAKVADFGLTKL+E+GN SLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVL+ELISAREA+VKTNEEVTESMGLVALFEDVLNQPDPR+DLQKLVDPRLG++YSFDAV KMARLA+ACTQENPQLRPSMR+IVVALM LSSS++DWDVGSLYENKAL++LM GR
Sbjct:  424 HFNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRQQRERDPLPWSARVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDKNFRAKVADFGLTKLSEFGNYSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLFELISAREAIVKTNEEVTESMGLVALFEDVLNQPDPREDLQKLVDPRLGNDYSFDAVCKMARLARACTQENPQLRPSMRSIVVALMALSSSSEDWDVGSLYENKALINLMPGR 674          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: B9RXG1_RICCO (Receptor protein kinase, putative OS=Ricinus communis GN=RCOM_0903580 PE=3 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 6.417e-155
Identity = 216/250 (86.40%), Postives = 234/250 (93.60%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLR  +RDPLPWL RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDKNFR KVADFGLTKLTEYG+ SL TRLVGTFGYMPPEYA+YG+VSPK+DVYAFGVVLYELISA+EAVVK NE +TES GLVALFEDVL+QPD  +DL KLVDPRLGDNY  D+V KMA+LAKACTQENPQLRPSMR+IVVALMTLSSST+DWDVG+LYEN+AL++LMSGR
Sbjct:  358 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRGSERDPLPWLTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFRGKVADFGLTKLTEYGSASLHTRLVGTFGYMPPEYARYGDVSPKIDVYAFGVVLYELISAKEAVVKANEIITESKGLVALFEDVLSQPDSNEDLCKLVDPRLGDNYPLDSVHKMAQLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGTLYENQALLNLMSGR 607          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A061DMJ0_THECC (Chitin elicitor receptor kinase 1, RLK1 isoform 1 OS=Theobroma cacao GN=TCM_002139 PE=3 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.444e-154
Identity = 210/250 (84.00%), Postives = 227/250 (90.80%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYE+IENGNLSQHLR   R+PLPW  RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDK FR KVADFGLTKLTE G+ SL TRLVGTFGYMPPEYAQYG+VSPKVDVYAFGVVLYELISA+EA+VK N  V ES GLVALFED LN+PDP++ L KL+DPRLGDNY  D+VFKMA+LAKACTQENPQLRPSMR+IVVALMTLSSST+DWDVGS YEN AL++LMSGR
Sbjct:   48 HLNLVRLIGYCVEGSLFLVYEYIENGNLSQHLRGSSREPLPWSTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKKFRGKVADFGLTKLTEVGSASLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKENGSVAESKGLVALFEDALNEPDPKEGLCKLIDPRLGDNYPLDSVFKMAQLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENHALVNLMSGR 297          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A067K708_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13726 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 2.764e-154
Identity = 209/250 (83.60%), Postives = 232/250 (92.80%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYE+IENGNLSQHLR  +RDPLPW +RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDKN+R KVADFGLTKLTE G+ SL TRLVGTFGYMPPEYAQYG+VSPKVDVYAFGVVLYELISA+EA+VK N    ES GLVALFEDVL++PDP ++L+KL+DPRLGDNY+FD+V KMA+LAKACTQENP LRPSMR+IVVALMTLSSST+DWDVGS YEN+AL++LMSGR
Sbjct:   21 HLNLVRLIGYCVEGSLFLVYEYIENGNLSQHLRGSERDPLPWSSRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYRGKVADFGLTKLTEVGSASLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKANGSNAESRGLVALFEDVLDEPDPEEELRKLIDPRLGDNYTFDSVRKMAQLAKACTQENPLLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 270          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A0A0QUA4_9ASTR (Chitin elicitor receptor kinase 1 OS=Chrysanthemum boreale PE=2 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 6.130e-152
Identity = 208/250 (83.20%), Postives = 225/250 (90.00%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHL    RDPLPW  RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDKNF  KVADFGLTKLTE G+ SL TRLVGTFGYMPPEYAQYG+VSPKVDVYAFGVVLYELISA+EA+VK N  VTES GLVALFE+VL+QPDP+ DL K++DPR+GDNY  D+V KMA+LAKACT ENPQLRPSMR+IVVALMTLSSST+DWDVGS YEN+ L+ LMSGR
Sbjct:  161 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLHGSARDPLPWSTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFHGKVADFGLTKLTEVGSNSLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKANGSVTESKGLVALFEEVLSQPDPKDDLIKIIDPRMGDNYPLDSVRKMAQLAKACTHENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQTLVSLMSGR 410          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: A0A0D2PAR4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G171300 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.000e-151
Identity = 204/250 (81.60%), Postives = 228/250 (91.20%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYE+IENGNLSQHLR   R+PLPW  RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDK FRAKVADFGLTKLTE GN+SL TRLVGTFGYMPPEYAQYG+VSPK+DV+AFGVVLYELISA+EA+VK N  + ES GLVALFED L++PDP+  L KL+DP LGDNY  D+VFKMA+LAKACTQENPQLRPSMR+IVVALMTLSS+T+DWDVG+ YEN+A+++LMSGR
Sbjct:   48 HLNLVRLIGYCVEGSLFLVYEYIENGNLSQHLRGSGREPLPWSTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKKFRAKVADFGLTKLTEVGNSSLPTRLVGTFGYMPPEYAQYGDVSPKIDVFAFGVVLYELISAKEAIVKANSSLAESKGLVALFEDGLDEPDPKAGLCKLIDPTLGDNYPLDSVFKMAQLAKACTQENPQLRPSMRSIVVALMTLSSTTEDWDVGTFYENQAVVNLMSGR 297          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: B9GTV3_POPTR (LysM domain-containing receptor-like kinase 4 family protein OS=Populus trichocarpa GN=POPTR_0002s21510g PE=3 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 6.987e-151
Identity = 211/250 (84.40%), Postives = 231/250 (92.40%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLR  ++DPLPW  RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDKNFR KVADFGLTKLTE G+TSL TRLVGTFGYMPPEYAQYG+VSPKVDVYA GVVLYELISA+EA+VK+N    ES GLVALFEDVLNQPDPR+DL+K+VDPRLG++Y  D+V KMA+L KACTQENPQLRPSMR+IVVALMTLSSST+DWDVGS YEN+AL++LMSGR
Sbjct:  332 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRGSEKDPLPWSTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFRGKVADFGLTKLTEVGSTSLPTRLVGTFGYMPPEYAQYGDVSPKVDVYALGVVLYELISAKEAIVKSNGSSAESRGLVALFEDVLNQPDPREDLRKVVDPRLGEDYPLDSVRKMAQLGKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 581          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Match: D7TEC1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0059g01130 PE=3 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 4.337e-150
Identity = 213/250 (85.20%), Postives = 230/250 (92.00%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            HLNLVRLIGYCVEGSLFLVYE+IENGNLSQHLR   RDPL W +RVQI LDSARGLEYIHEHTVP+YIHRDIKSANILIDKNF  KVADFGLTKLTE G++SL TRLVGTFGYMPPEYAQYG+VSPKVDVYAFGVVLYELISA+EAVVK N  V ES GLVALFEDVLN+PDPR+DL+KLVDPRL DNY  D+V KMA+LAKACTQENPQLRPSMRTIVVALMTLSSST+DWDVGS Y+N+AL++LMSGR
Sbjct:  376 HLNLVRLIGYCVEGSLFLVYEYIENGNLSQHLRGSGRDPLQWSSRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFHGKVADFGLTKLTEVGSSSLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAVVKDNGSVAESKGLVALFEDVLNKPDPREDLRKLVDPRLEDNYPLDSVRKMAQLAKACTQENPQLRPSMRTIVVALMTLSSSTEDWDVGSFYDNQALVNLMSGR 625          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: CERK1_ARATH (Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.778e-119
Identity = 176/250 (70.40%), Postives = 204/250 (81.60%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            H+NLVRLIGYCVEGSLFLVYE++ENGNL QHL    R+PLPW  RVQI LDSARGLEYIHEHTVP+Y+HRDIKSANILID+ FRAKVADFGLTKLTE G ++ +  + GTFGYM PE   YGEVS KVDVYAFGVVLYELISA+ AVVK  E V E  GLV +FE+   + D  + L+K++DPRLGD+Y FD+V+KMA L KACTQEN QLRPSMR IVVAL TL SST +WDVG+ ++N+ L+ LMSGR
Sbjct:  371 HVNLVRLIGYCVEGSLFLVYEYVENGNLGQHLHGSGREPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEVGGSATRGAM-GTFGYMAPETV-YGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGN-FQNEDLVSLMSGR 617          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: CERK1_ORYSJ (Chitin elicitor receptor kinase 1 OS=Oryza sativa subsp. japonica GN=CERK1 PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.094e-101
Identity = 157/236 (66.53%), Postives = 194/236 (82.20%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNT--SLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDV 704
            HLNLVRLIGYCVE  LFLVYEFI+NGNLSQHL+     PL W  RVQI LDSARGLEY+HEH VP+Y+HRDIKSANIL+DK+FRAK+ADFGL KLTE G+   SL TR+ GTFGYMPPE A+YGEVSPKVDVYAFGVVLYEL+SA++A+V+++E V+ES GLV LFE+ L+ P+P + L +L+DP L  +Y  D+  K+A LAK+CT E P +RP+MR++VVALM L+++TD  D+
Sbjct:  366 HLNLVRLIGYCVENCLFLVYEFIDNGNLSQHLQRTGYAPLSWATRVQIALDSARGLEYLHEHVVPVYVHRDIKSANILLDKDFRAKIADFGLAKLTEVGSMSQSLSTRVAGTFGYMPPE-ARYGEVSPKVDVYAFGVVLYELLSAKQAIVRSSESVSESKGLVFLFEEALSAPNPTEALDELIDPSLQGDYPVDSALKIASLAKSCTHEEPGMRPTMRSVVVALMALTANTDLRDM 600          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: LYK3_ARATH (LysM domain receptor-like kinase 3 OS=Arabidopsis thaliana GN=LYK3 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.050e-64
Identity = 120/263 (45.63%), Postives = 166/263 (63.12%), Query Frame = 3
Query:    3 HLNLVRLIGYCVE-GSLFLVYEFIENGNLSQHL---RWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEY---GNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVT---ESMGLVALFEDVL-NQPDPRQ--DLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWDVGSLYENKALMDLMSGR 752
            H NLV LIGY      LF+VYE++  G L  HL   + +   PL W+ R QI LD+ARGLEYIHEHT   Y+HRDIK++NIL+D+ FRAK++DFGL KL E    G  S+ T++VGT+GY+ PEY   G  + K D+YAFGVVL+E+IS REAV++T    T   E   L ++   VL N PD      L++ VDP + D Y  D +FK+A LAK C  ++P LRP+M+ +V++L  +  S+ +W+      ++    L+ GR
Sbjct:  390 HSNLVELIGYAATVDELFVVYEYVRKGMLKSHLHDPQSKGNTPLSWIMRNQIALDAARGLEYIHEHTKTHYVHRDIKTSNILLDEAFRAKISDFGLAKLVEKTGEGEISV-TKVVGTYGYLAPEYLSDGLATSKSDIYAFGVVLFEIISGREAVIRTEAIGTKNPERRPLASIMLAVLKNSPDSMNMSSLKEFVDPNMMDLYPHDCLFKIATLAKQCVDDDPILRPNMKQVVISLSQILLSSIEWEATLAGNSQVFSGLVQGR 651          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PERK1_ARATH (Proline-rich receptor-like protein kinase PERK1 OS=Arabidopsis thaliana GN=PERK1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.365e-56
Identity = 103/223 (46.19%), Postives = 138/223 (61.88%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEG-SLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVAL 668
            H +LV LIGYC+ G    LVYEF+ N NL  HL  + R  + W  R++I L SA+GL Y+HE   P  IHRDIK++NILID  F AKVADFGL K+    NT + TR++GTFGY+ PEYA  G+++ K DV++FGVVL ELI+ R  V   N  V +S  LV     +LN+     D + L D ++G+ Y  + + +M   A AC + + + RP M  IV AL
Sbjct:  333 HRHLVSLIGYCMAGVQRLLVYEFVPNNNLEFHLHGKGRPTMEWSTRLKIALGSAKGLSYLHEDCNPKIIHRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVFSFGVVLLELITGRRPVDANNVYVDDS--LVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAACVRHSARRRPRMSQIVRAL 553          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PERK8_ARATH (Proline-rich receptor-like protein kinase PERK8 OS=Arabidopsis thaliana GN=PERK8 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.357e-54
Identity = 103/233 (44.21%), Postives = 142/233 (60.94%), Query Frame = 3
Query:    3 HLNLVRLIGYCV-EGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEY--GNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTD 692
            H +LV L+GYC+ E    LVY+++ N  L  HL    R  + W  RV++   +ARG+ Y+HE   P  IHRDIKS+NIL+D +F A VADFGL K+ +    NT + TR++GTFGYM PEYA  G++S K DVY++GV+L ELI+ R+ V  +     ES  LV     +L Q    ++  +LVDPRLG N+    +F+M   A AC + +   RP M  +V AL TL  +TD
Sbjct:  392 HRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDES--LVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATD 622          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: LYK5_ARATH (Protein LYK5 OS=Arabidopsis thaliana GN=LYK5 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.904e-53
Identity = 97/238 (40.76%), Postives = 151/238 (63.45%), Query Frame = 3
Query:    3 HLNLVRLIGYCV-EGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQ-TRLV-GTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVV--KTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTDDWD 701
            H N++RL G+C+ EG+ +LV+E+ ENG++S  L    +  L W  RV+I  D A  L+Y+H +  P +IH++++S NIL+D NFRAK+A+FG+ ++ + G+  LQ TR V GT GY+ PEY + G ++ K+DV+AFGV + EL+S REAV   K  E   E   L  +   VL   + R+ L++ +DP LG+ Y  +  + MA+LAK+C   +   RPS+  ++  L  + SS+ DW+
Sbjct:  414 HSNIIRLSGFCIREGTSYLVFEYSENGSISDWLHSSGKKSLTWKQRVEIARDVAEALDYLHNYITPPHIHKNLESTNILLDSNFRAKIANFGVARILDEGDLDLQLTRHVEGTQGYLAPEYVENGVITSKLDVFAFGVAVLELLSGREAVTIHKKKEGEEEVEMLCKVINSVLGGENVREKLKEFMDPSLGNEYPLELAYTMAQLAKSCVATDLNSRPSVTQVLTTLSMIVSSSIDWE 651          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PEK13_ARATH (Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.470e-52
Identity = 101/223 (45.29%), Postives = 138/223 (61.88%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGS-LFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVAL 668
            H +LV L+GYC+  S   L+YE++ N  L  HL  + R  L W  RV+I + SA+GL Y+HE   P  IHRDIKSANIL+D  F A+VADFGL KL +   T + TR++GTFGY+ PEYAQ G+++ + DV++FGVVL ELI+ R+ V +      ES  LV     +L++     D  +LVD RL  +Y  + VF+M   A AC + +   RP M  +V AL
Sbjct:  406 HRHLVSLVGYCIADSERLLIYEYVPNQTLEHHLHGKGRPVLEWARRVRIAIGSAKGLAYLHEDCHPKIIHRDIKSANILLDDEFEAQVADFGLAKLNDSTQTHVSTRVMGTFGYLAPEYAQSGKLTDRSDVFSFGVVLLELITGRKPVDQYQPLGEES--LVEWARPLLHKAIETGDFSELVDRRLEKHYVENEVFRMIETAAACVRHSGPKRPRMVQVVRAL 626          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PERK3_ARATH (Proline-rich receptor-like protein kinase PERK3 OS=Arabidopsis thaliana GN=PERK3 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 3.864e-52
Identity = 100/231 (43.29%), Postives = 137/231 (59.31%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGS-LFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLSSSTD 692
            H NLV L+GYC+ G+   LVYEF+ N  L  HL  + R  + W  R++I + S++GL Y+HE+  P  IHRDIK+ANILID  F AKVADFGL K+    NT + TR++GTFGY+ PEYA  G+++ K DVY+FGVVL ELI+ R  V   N    +S  LV     +L Q     + + L D +L + Y  + + +M   A AC +   + RP M  +V  L    S +D
Sbjct:  236 HRNLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPTMEWSLRLKIAVSSSKGLSYLHENCNPKIIHRDIKAANILIDFKFEAKVADFGLAKIALDTNTHVSTRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDS--LVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNISPSD 464          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PEK10_ARATH (Proline-rich receptor-like protein kinase PERK10 OS=Arabidopsis thaliana GN=PERK10 PE=2 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 7.029e-52
Identity = 99/227 (43.61%), Postives = 136/227 (59.91%), Query Frame = 3
Query:    3 HLNLVRLIGYCV-EGSLFLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVALMTLS 680
            H NL+ ++GYC+ E    L+Y+++ N NL  HL       L W  RV+I   +ARGL Y+HE   P  IHRDIKS+NIL++ NF A V+DFGL KL    NT + TR++GTFGYM PEYA  G+++ K DV++FGVVL ELI+ R+ V  +     ES  LV     +L+     ++   L DP+LG NY    +F+M   A AC + +   RP M  IV A  +L+
Sbjct:  483 HRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDES--LVEWARPLLSNATETEEFTALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSLA 707          
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Match: PERK5_ARATH (Proline-rich receptor-like protein kinase PERK5 OS=Arabidopsis thaliana GN=PERK5 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.348e-51
Identity = 105/223 (47.09%), Postives = 137/223 (61.43%), Query Frame = 3
Query:    3 HLNLVRLIGYCVEGSL-FLVYEFIENGNLSQHLRWQDRDPLPWLARVQIGLDSARGLEYIHEHTVPLYIHRDIKSANILIDKNFRAKVADFGLTKLTEYGNTSLQTRLVGTFGYMPPEYAQYGEVSPKVDVYAFGVVLYELISAREAVVKTNEEVTESMGLVALFEDVLNQPDPRQDLQKLVDPRLGDNYSFDAVFKMARLAKACTQENPQLRPSMRTIVVAL 668
            H +LV L+GYC+ G    LVYEFI N  L  HL  + R  L W  RV+I L SARGL Y+HE   P  IHRDIK+ANIL+D +F  KVADFGL KL++   T + TR++GTFGY+ PEYA  G++S K DV++FGV+L ELI+ R  +  T  E+ +S  LV     +  +     D  +L DPRL  NYS   + +MA  A A  + + + RP M  IV AL
Sbjct:  365 HRHLVSLVGYCISGGQRLLVYEFIPNNTLEFHLHGKGRPVLDWPTRVKIALGSARGLAYLHEDCHPRIIHRDIKAANILLDFSFETKVADFGLAKLSQDNYTHVSTRVMGTFGYLAPEYASSGKLSDKSDVFSFGVMLLELITGRPPLDLTG-EMEDS--LVDWARPLCLKAAQDGDYNQLADPRLELNYSHQEMVQMASCAAAAIRHSARRRPKMSQIVRAL 584          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MM60_GOSAR4.709e-179100.00Proline-rich receptor-like protein kinase PERK1 OS... [more]
A0A0D2VGR1_GOSRA3.209e-17899.60Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GHZ8_THECC4.586e-16190.04Chitin elicitor receptor kinase 1, RLK1 OS=Theobro... [more]
B9RXG1_RICCO6.417e-15586.40Receptor protein kinase, putative OS=Ricinus commu... [more]
A0A061DMJ0_THECC1.444e-15484.00Chitin elicitor receptor kinase 1, RLK1 isoform 1 ... [more]
A0A067K708_JATCU2.764e-15483.60Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A0A0QUA4_9ASTR6.130e-15283.20Chitin elicitor receptor kinase 1 OS=Chrysanthemum... [more]
A0A0D2PAR4_GOSRA1.000e-15181.60Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9GTV3_POPTR6.987e-15184.40LysM domain-containing receptor-like kinase 4 fami... [more]
D7TEC1_VITVI4.337e-15085.20Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0016082 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
CERK1_ARATH3.778e-11970.40Chitin elicitor receptor kinase 1 OS=Arabidopsis t... [more]
CERK1_ORYSJ1.094e-10166.53Chitin elicitor receptor kinase 1 OS=Oryza sativa ... [more]
LYK3_ARATH4.050e-6445.63LysM domain receptor-like kinase 3 OS=Arabidopsis ... [more]
PERK1_ARATH2.365e-5646.19Proline-rich receptor-like protein kinase PERK1 OS... [more]
PERK8_ARATH4.357e-5444.21Proline-rich receptor-like protein kinase PERK8 OS... [more]
LYK5_ARATH1.904e-5340.76Protein LYK5 OS=Arabidopsis thaliana GN=LYK5 PE=2 ... [more]
PEK13_ARATH3.470e-5245.29Proline-rich receptor-like protein kinase PERK13 O... [more]
PERK3_ARATH3.864e-5243.29Proline-rich receptor-like protein kinase PERK3 OS... [more]
PEK10_ARATH7.029e-5243.61Proline-rich receptor-like protein kinase PERK10 O... [more]
PERK5_ARATH1.348e-5147.09Proline-rich receptor-like protein kinase PERK5 OS... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 2..223
e-value: 1.0E-10
score: 18.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..224
score: 29.248
NoneNo IPR availableGENE3D1.10.510.10coord: 30..220
e-value: 4.1E-42
score: 143.4
NoneNo IPR availableGENE3D3.30.200.20coord: 2..29
e-value: 3.7E-4
score: 19.7
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 1..236
e-value: 5.9E-29
score: 98.6
NoneNo IPR availablePANTHERPTHR27001:SF12CHITIN ELICITOR RECEPTOR KINASE 1coord: 1..249
NoneNo IPR availablePANTHERPTHR27001FAMILY NOT NAMEDcoord: 1..249
IPR001245Serine-threonine/tyrosine-protein kinase catalytic domainPFAMPF07714Pkinase_Tyrcoord: 2..220
e-value: 6.3E-34
score: 117.3
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 66..78
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 2..227

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0016082 ID=g.arboreum_cottongen_reftransV1_0016082|Name=g.arboreum_cottongen_reftransV1_0016082|organism=Gossypium arboreum|type=contig|length=845bp
ATCATTTGAACCTGGTTCGTTTAATTGGATATTGTGTCGAAGGTTCCTTA
TTCTTAGTCTACGAGTTCATCGAGAACGGTAATTTAAGCCAACATTTACG
CTGGCAAGATAGAGATCCGTTGCCATGGTTAGCAAGGGTGCAAATCGGTT
TAGACTCGGCCAGAGGACTCGAATACATCCATGAACATACTGTCCCTCTC
TACATTCATCGTGATATAAAATCGGCAAATATTTTAATCGACAAGAACTT
TCGAGCTAAGGTGGCTGATTTTGGGTTGACGAAACTAACTGAATACGGAA
ACACTTCGTTGCAAACACGTCTCGTTGGTACTTTCGGATACATGCCACCA
GAATATGCTCAATATGGTGAGGTTTCCCCTAAGGTTGATGTGTATGCTTT
TGGAGTTGTTCTCTACGAACTGATATCCGCCAGGGAAGCTGTCGTCAAGA
CGAACGAAGAAGTAACTGAATCAATGGGACTCGTCGCATTGTTCGAAGAT
GTTCTAAACCAACCCGATCCAAGACAAGATCTGCAAAAACTAGTTGACCC
CAGACTCGGCGATAACTACTCTTTTGATGCCGTCTTCAAGATGGCACGTC
TCGCCAAGGCTTGTACGCAAGAAAATCCTCAGCTGAGACCGAGCATGAGA
ACTATTGTCGTCGCACTTATGACACTGTCGTCTTCAACCGATGATTGGGA
TGTTGGCTCGTTATACGAAAATAAAGCTCTAATGGACCTCATGTCGGGAA
GGTAGCTTAGCCAGAGTCATTAAAGGGGTTAATCAATGAATAGGCTGTGA
ATACTTTAAATTTTAATAGGCTATGTACAGTTTCTTTCACCAAGT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation