g.arboreum_cottongen_reftransV1_0015984, g.arboreum_cottongen_reftransV1_0015984 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0015984
Unique Nameg.arboreum_cottongen_reftransV1_0015984
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length908
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr3chromosomeg.arboreum_cottongen_reftransV1_0015984:1..908 .
Chr3:9252835..9255295 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A0B0NCG2_GOSAR (Light-inducible CPRF2 OS=Gossypium arboreum GN=F383_14363 PE=4 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 301/302 (99.67%), Postives = 302/302 (100.00%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKR+CGGIS
Sbjct:  102 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRMCGGIS 403          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A0D2R3Q8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G246700 PE=4 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 297/302 (98.34%), Postives = 298/302 (98.68%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQS SIATSKGAGDK+GNA SGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFH SPEISTAGMSSFDGSPSDTSTEAA SVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS
Sbjct:  102 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSVSIATSKGAGDKNGNALSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHTSPEISTAGMSSFDGSPSDTSTEAAASVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 403          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A061F207_THECC (Light-inducible protein CPRF-2, putative OS=Theobroma cacao GN=TCM_026349 PE=4 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.278e-155
Identity = 251/302 (83.11%), Postives = 271/302 (89.74%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK KLNLACAAVAMSRASF+K QDSA RADSGSQAS++PQ GS ATSKGAG+KDGNA    PS+ NGQKK  AQVRPSTSGSSRE+SE+DEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQV QLRVENA+L+KRL DISQKYNE+AVDNRVLKADVETLRAKVKMAE++VKRITGL+P+ H SPEIST  MSSFDGSPSDTST+AAV VQDGPKHPLY+AAAN PI  HDLR +NALADISS ENIQP S  S+V GNKIG T S+QRVASLEHLQKRI GG+S
Sbjct:  102 FLKTKLNLACAAVAMSRASFLKSQDSAARADSGSQASNSPQLGSKATSKGAGNKDGNAPVEIPSLPNGQKKSVAQVRPSTSGSSRELSEEDEVEGENETMENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVGQLRVENASLMKRLADISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLHGSPEISTMAMSSFDGSPSDTSTDAAVPVQDGPKHPLYRAAANNPIFAHDLRVSNALADISSAENIQPNSGGSTVPGNKIGWTASLQRVASLEHLQKRIRGGVS 403          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A0D2PFQ0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G277300 PE=4 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.449e-152
Identity = 240/303 (79.21%), Postives = 265/303 (87.46%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTS-GSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK KLNLACAAVAMS ASF KPQDSA RADSG QAS+TPQ GS   S+GAGDKD NA +  PS  +GQKK+ AQVRPSTS GSS+E S++DEVEGENETMENMDPAD KRVRRMLSNRESARRSRRRKQAHLTELE+QVSQLRVENA LLK LTDISQ+YNE+AV+NR+LKADVETL+AKVKMA ++VKR TGL+PVFHA PEI +  MSSFDG PSDTST+AAV  +DGPKH LYQAAAN  ISTH+LR NNALADISSVENIQP SE S+V+GNKIGRT S+QRVASLEHLQKRI GG+S
Sbjct:  104 FLKKKLNLACAAVAMSMASFAKPQDSAARADSGPQASNTPQLGSKTVSRGAGDKDDNAVAEVPSFPSGQKKLRAQVRPSTSTGSSKEQSDEDEVEGENETMENMDPADVKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENANLLKSLTDISQRYNEAAVNNRILKADVETLKAKVKMAVEAVKRTTGLNPVFHALPEIPS--MSSFDGCPSDTSTDAAVYEEDGPKHTLYQAAANDSISTHELRINNALADISSVENIQPVSEGSAVTGNKIGRTASLQRVASLEHLQKRIHGGVS 404          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A0D2R0F6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G277300 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.235e-151
Identity = 239/304 (78.62%), Postives = 265/304 (87.17%), Query Frame = 3
Query:    3 FLKN-KLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTS-GSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FL+  KLNLACAAVAMS ASF KPQDSA RADSG QAS+TPQ GS   S+GAGDKD NA +  PS  +GQKK+ AQVRPSTS GSS+E S++DEVEGENETMENMDPAD KRVRRMLSNRESARRSRRRKQAHLTELE+QVSQLRVENA LLK LTDISQ+YNE+AV+NR+LKADVETL+AKVKMA ++VKR TGL+PVFHA PEI +  MSSFDG PSDTST+AAV  +DGPKH LYQAAAN  ISTH+LR NNALADISSVENIQP SE S+V+GNKIGRT S+QRVASLEHLQKRI GG+S
Sbjct:   47 FLREEKLNLACAAVAMSMASFAKPQDSAARADSGPQASNTPQLGSKTVSRGAGDKDDNAVAEVPSFPSGQKKLRAQVRPSTSTGSSKEQSDEDEVEGENETMENMDPADVKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENANLLKSLTDISQRYNEAAVNNRILKADVETLKAKVKMAVEAVKRTTGLNPVFHALPEIPS--MSSFDGCPSDTSTDAAVYEEDGPKHTLYQAAANDSISTHELRINNALADISSVENIQPVSEGSAVTGNKIGRTASLQRVASLEHLQKRIHGGVS 348          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A0A0B0P269_GOSAR (Light-inducible CPRF2 OS=Gossypium arboreum GN=F383_23731 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 2.603e-149
Identity = 237/303 (78.22%), Postives = 261/303 (86.14%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTS-GSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK KLNLACAAVAMS ASF KPQDSA RAD GSQAS+TPQ GS   S+G GDKD NA +   S  +GQKK  AQVRPSTS GSS+E S++DEVEGENET ENMDPAD KRVRRMLSNRESARRSRRRKQAHLTELE+QVSQLRVENA LLK LTDISQ+YNE+AV+NR+LKADVETL+AKVKMAE++VKR TGL+PVFHA PEI +  MSSFDG PS+TST+AAV  +DGPKH LYQAAAN  ISTHDLR NNALADISSVENIQP SE S+V+GNKIGRT S+ RVASLEHLQKRI GG+S
Sbjct:   85 FLKKKLNLACAAVAMSMASFAKPQDSATRADRGSQASNTPQLGSKTVSRGTGDKDDNAVAEVLSFPSGQKKFRAQVRPSTSTGSSKEQSDEDEVEGENETTENMDPADVKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENADLLKSLTDISQRYNEAAVNNRILKADVETLKAKVKMAEEAVKRTTGLNPVFHALPEIPS--MSSFDGCPSETSTDAAVYEEDGPKHTLYQAAANDSISTHDLRINNALADISSVENIQPVSEGSAVTGNKIGRTASLHRVASLEHLQKRIRGGVS 385          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: B9SZ77_RICCO (Light-inducible protein CPRF-2, putative OS=Ricinus communis GN=RCOM_0484650 PE=4 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.392e-134
Identity = 222/309 (71.84%), Postives = 250/309 (80.91%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAG---------DKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGG 902
            FLK+KLNLACAAVA SRASF+KP+DS+ RADSG QAS+T Q GS A SKGAG         D DG+   G PS+ +  KK    ++P+TSGSSRE S+DDE EGE E  ENMDP DAKRVRRMLSNRESARRSRRRKQAHLTELETQV+QLRVEN++LLKRLTDIS KYNESAVDNRVLKADVETLRAKVKMAE++VKRITGL+ +FH  PE+ST  M SFDGSPSDTST+AAV VQD  +H  YQ   N P+STHD R NNALADISSVEN+QP S  + + GNK+GRT S+QRVASLEHLQKRI GG
Sbjct:  135 FLKSKLNLACAAVAQSRASFLKPEDSSARADSGLQASNTSQLGSHAPSKGAGHDVFRSQEVDVDGSV--GIPSLPSTHKKSVVPLKPTTSGSSREQSDDDENEGETELTENMDPTDAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRVENSSLLKRLTDISHKYNESAVDNRVLKADVETLRAKVKMAEETVKRITGLNSLFHTIPEMSTMSMPSFDGSPSDTSTDAAVPVQDDTEHQFYQ-PPNNPLSTHDPRVNNALADISSVENVQPHSGAAGLGGNKMGRTASLQRVASLEHLQKRIRGG 440          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: B9I5F3_POPTR (BZIP transcription factor family protein OS=Populus trichocarpa GN=POPTR_0013s03800g PE=4 SV=2)

HSP 1 Score: 392.889 bits (1008), Expect = 5.250e-132
Identity = 223/312 (71.47%), Postives = 251/312 (80.45%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAG-------DKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRT--NNALADISSVENIQPKS-EVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK+KLNLACAAVA++RASFVKP DS   A+SGSQAS+T Q GS A SKGAG       DKD N   G PS+ + Q+K    V+P+TS SSRE+SEDDE E E E  ENM PADAKRVRRMLSNRESARRSR RKQAHLTELETQV+QLRVEN++LLK LTDISQKYNESAVDNRVLKADVETLRAKVKMAE++VKR TGL+ +FHA P+IST  MSSFDGSPSDT+ +AAV V+D PKH  Y+ A N PI+THD R   NN LADISSVEN+QP     + VSGNK+GRTPS+QRVASLEHLQKRI GG S
Sbjct:   78 FLKSKLNLACAAVALTRASFVKPLDSPAAAESGSQASNTSQLGSHAPSKGAGYDLPISQDKDANEPLGTPSLPSMQRKSAVTVKPTTSVSSRELSEDDENEAETELTENMQPADAKRVRRMLSNRESARRSRSRKQAHLTELETQVAQLRVENSSLLKSLTDISQKYNESAVDNRVLKADVETLRAKVKMAEETVKRFTGLNTMFHALPDISTMSMSSFDGSPSDTA-DAAVPVKDDPKHHFYK-APNNPITTHDSRPRGNNVLADISSVENVQPNPVPAAGVSGNKMGRTPSLQRVASLEHLQKRIRGGAS 387          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: F6HTR1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0030g02200 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.217e-130
Identity = 216/309 (69.90%), Postives = 250/309 (80.91%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAG-------DKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK++LNLACAAVA+SRASFVKPQDSA  AD+GSQAS T Q  S A  KG+G       DK+     G PS+   QKK GAQ+RP+TS SSRE S+DDEVEGE ET+ENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQV+QLR+EN++LLKRLTDISQKYNE+AVDNRVLKADVETLRAKVKMAE++VKR+TGL+P+F    EIS AGM SFDGSPSDTS +AAV VQD PK   Y + ++  ISTHD R NN LAD+SSVE++      +  +GNK+GRT S+QRVASLEHLQKRI G ++
Sbjct:  106 FLKSRLNLACAAVALSRASFVKPQDSAALADTGSQASKTSQLRSQAPCKGSGYDLSGAPDKEAGGPLGIPSLPAMQKKAGAQLRPTTSESSREHSDDDEVEGETETIENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRLENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRVTGLNPLFQTMSEISMAGMHSFDGSPSDTSADAAVPVQDEPKQHFYPSPSDNLISTHDPRINNGLADVSSVESVLQNPAAAGAAGNKMGRTASLQRVASLEHLQKRIRGAVN 414          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Match: A5BP13_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_022136 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 3.116e-126
Identity = 216/326 (66.26%), Postives = 250/326 (76.69%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSR-----------------ASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAG-------DKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            FLK++LNLACAAVA+SR                 ASFVKPQDSA  AD+GSQAS T Q  S A  KG+G       DK+     G PS+   QKK GAQ+RP+TS SSRE S+DDEVEGE ET+ENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQV+QLR+EN++LLKRLTDISQKYNE+AVDNRVLKADVETLRAKVKMAE++VKR+TGL+P+F    EIS AGM SFDGSPSDTS +AAV VQD PK   Y + ++  ISTHD R NN LAD+SSVE++      +  +GNK+GRT S+QRVASLEHLQKRI G ++
Sbjct:  104 FLKSRLNLACAAVALSRVTVDQLPLPLHKLQIIQASFVKPQDSAALADTGSQASKTSQLRSQAPCKGSGYDLSGAPDKEAGGPLGIPSLPAMQKKAGAQLRPTTSESSREHSDDDEVEGETETIENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRLENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRVTGLNPLFQTMSEISMAGMHSFDGSPSDTSADAAVPVQDEPKQHFYPSPSDNLISTHDPRINNGLADVSSVESVLQNPAAAGAAGNKMGRTASLQRVASLEHLQKRIRGAVN 429          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: CPRF2_PETCR (Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 4.374e-101
Identity = 191/311 (61.41%), Postives = 233/311 (74.92%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAG-------DKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDD-EVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHA-SPEISTAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRICGGIS 908
            +LK++L+LACAAVA++RAS +KPQDSA   D+GSQAS+T Q  S    KG+G       DK+  A +  P +   QKK   QV+ +TSGSSR+ S+DD E+EGE ET  N DP+DAKRVRRMLSNRESARRSRRRKQAH+TELETQVSQLRVEN++LLKRLTDISQ+YN++AVDNRVLKAD+ET+RAKVKMAE++VKR+TGL+P+F + S EIST GM SF GSPSDTS +   + QDG K   YQ A    +   D +  N L  +  V+N+Q  S    V GNK+ RT SMQRVASLEHLQKRI GG+S
Sbjct:   84 YLKSRLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPKGSGHDLSKEEDKEALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSDAKRVRRMLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDNRVLKADIETMRAKVKMAEETVKRVTGLNPMFQSMSSEISTIGMQSFSGSPSDTSAD---TTQDGSKQHFYQPAPTSHMPAQDQKIQNGLLQVPPVDNLQQHSASGPVEGNKMERTSSMQRVASLEHLQKRIRGGVS 391          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: BZP63_ARATH (Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.068e-61
Identity = 142/298 (47.65%), Postives = 192/298 (64.43%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEI-STAGMSSFDGSPSDTSTEAAVSVQDGPKHPLYQAAANKPISTHDLRTNNALADISSVENIQPKSEVSSVSGNKIGRTPSMQRVASLEHLQKRI 893
            FLK+KLNLACAAVAM R +F+KPQD++ R+D+G   ++  +  S+A+SK        A     S +             TSGS  E+S D+E E + ET  NM+P + KRV+RMLSNRESARRSRRRKQAHL+ELETQVSQLRVEN+ L+K LTD++Q +N+++V+NRVLKA++ETLRAKVKMAE++VKR+TG +P+FH  P+I ST  +      PS+TS                    N P +T         + +++ E I   ++  ++ G K+ RT SM+RV SLEHLQKRI
Sbjct:   73 FLKSKLNLACAAVAMKRGTFIKPQDTSGRSDNG--GANESEQASLASSK--------ATPMMSSAI-------------TSGS--ELSGDEE-EADGET--NMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDASVENRVLKANIETLRAKVKMAEETVKRLTGFNPMFHNMPQIVSTVSL------PSETS--------------------NSPDTTS--------SQVTTPEIISSGNKGKALIGCKMNRTASMRRVESLEHLQKRI 308          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: BZP25_ARATH (Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.885e-35
Identity = 107/223 (47.98%), Postives = 145/223 (65.02%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIA--TSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVFHASPEISTAGMSSFDGSPSDTST 665
             LK+KL LACAAVA  R   VKP+DS+  A +  QA      GSI   TS GA      +   F    + QKK     R  TS SSR+ S+DD+++G+ +  +   P D KR RRMLSNRESARRSRRRKQ  + E +TQV QLR E++TL+ RL+D++ KY+ +AVDNR+L+AD+ETLR KVKMAE++VKR+TG++P+  + P +       F  +PS +S+
Sbjct:  137 ILKSKLELACAAVA-RRVGTVKPEDSSASASNQKQAQ-----GSIVAQTSPGA------SSVRFSPTTSTQKKPDVPAR-QTSISSRDDSDDDDLDGDADNGD---PTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIP----FSNTPSASSS 339          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: BZP10_ARATH (Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 9.698e-35
Identity = 98/197 (49.75%), Postives = 134/197 (68.02%), Query Frame = 3
Query:    6 LKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDEVEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRITGLSPVF 596
            LKNKL   CA V   R   VKP+DS    ++  Q    P   S  T    G       S  P+ V   KK G  ++  TSGSSRE S+D++++ ENET  ++ P D K+ RRMLSNRESARRSRRRKQ   ++LETQV+ L+ E+++LLK+L++++ KY+E+AV NR+LKAD+ETLRAKVKMAE++VKR+TG++P+ 
Sbjct:  122 LKNKLETECATVVSLRVGSVKPEDSTSSPETQLQ----PVQSSPLTQGELG-----VTSSLPAEV---KKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPML 306          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: OP2_MAIZE (Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.139e-22
Identity = 90/192 (46.88%), Postives = 118/192 (61.46%), Query Frame = 3
Query:    3 FLKNKLNLACAAVAMSRASFVKPQDSAVRADSGSQASDTPQSGSIATSKGAGDKDGNAQSGFPSVVNGQKKIGAQVRPSTSGSSREMSEDDE-VEGENETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKRI 575
             L+ KL     A  M RA       S V +D  SQ S+    GS   +    +K  N +   P   N  +  G  VR +TS SSR+ S  DE ++GE E +    P + +RVR+  SNRESARRSR RK AHL ELE QV+QL+ EN+ LL+R+  ++QKYN++ VDNRVL+AD+ETLRAKVKM EDS+KR+
Sbjct:  126 ILRRKLEEDLEAFKMWRAD-----SSVVTSDQRSQGSNNHTGGSSIRNNPVQNKLMNGED--PINNNHAQTAGLGVRLATSSSSRDPSPSDEDMDGEVEILGFKMPTE-ERVRKKESNRESARRSRYRKAAHLKELEDQVAQLKAENSCLLRRIAALNQKYNDANVDNRVLRADMETLRAKVKMGEDSLKRV 309          
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Match: BZIP9_ARATH (Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.380e-22
Identity = 74/149 (49.66%), Postives = 96/149 (64.43%), Query Frame = 3
Query:  228 VRPSTSGSSREMSEDDEVEGE--NETMENMDPADAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENATLLKRLTDISQKYNESAVDNRVLKADVETLRAKVKMAEDSVKR-----------ITGLSPVFHASPEISTAGMSS 635
            VR +TSGSS   S+D++ E E     M N DP D KR+RRM SNRESA+RSRRRKQ +L +LETQV  L+ +N+TL K+L D +Q++  +  +NRVLK+DVETLR KVK+AED V R            T LSP  H+   +   G +S
Sbjct:   88 VRRTTSGSSHVNSDDEDAETEAGQSEMTN-DPNDLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQQFRSAGTNNRVLKSDVETLRVKVKLAEDLVARGSLTSSLNQLLQTHLSPPSHSISSLHYTGNTS 235          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NCG2_GOSAR0.000e+099.67Light-inducible CPRF2 OS=Gossypium arboreum GN=F38... [more]
A0A0D2R3Q8_GOSRA0.000e+098.34Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061F207_THECC1.278e-15583.11Light-inducible protein CPRF-2, putative OS=Theobr... [more]
A0A0D2PFQ0_GOSRA1.449e-15279.21Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2R0F6_GOSRA2.235e-15178.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P269_GOSAR2.603e-14978.22Light-inducible CPRF2 OS=Gossypium arboreum GN=F38... [more]
B9SZ77_RICCO5.392e-13471.84Light-inducible protein CPRF-2, putative OS=Ricinu... [more]
B9I5F3_POPTR5.250e-13271.47BZIP transcription factor family protein OS=Populu... [more]
F6HTR1_VITVI1.217e-13069.90Putative uncharacterized protein OS=Vitis vinifera... [more]
A5BP13_VITVI3.116e-12666.26Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0015984 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
CPRF2_PETCR4.374e-10161.41Light-inducible protein CPRF2 OS=Petroselinum cris... [more]
BZP63_ARATH1.068e-6147.65Basic leucine zipper 63 OS=Arabidopsis thaliana GN... [more]
BZP25_ARATH2.885e-3547.98Basic leucine zipper 25 OS=Arabidopsis thaliana GN... [more]
BZP10_ARATH9.698e-3549.75Basic leucine zipper 10 OS=Arabidopsis thaliana GN... [more]
OP2_MAIZE1.139e-2246.88Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1... [more]
BZIP9_ARATH1.380e-2249.66Basic leucine zipper 9 OS=Arabidopsis thaliana GN=... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 160..180
NoneNo IPR availableCOILSCoilCoilcoord: 111..145
NoneNo IPR availableGENE3D1.20.5.170coord: 102..154
e-value: 7.9E-13
score: 47.8
NoneNo IPR availablePANTHERPTHR22952CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATEDcoord: 4..224
NoneNo IPR availablePANTHERPTHR22952:SF90BASIC LEUCINE ZIPPER 63coord: 4..224
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..23
score: 0.465
NoneNo IPR availableSUPERFAMILY57959Leucine zipper domaincoord: 102..152
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 98..162
e-value: 9.0E-19
score: 78.4
IPR004827Basic-leucine zipper domainPFAMPF00170bZIP_1coord: 101..154
e-value: 5.3E-14
score: 51.9
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 105..120
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 100..155
score: 11.588
IPR020983Basic leucine-zipper, C-terminalPFAMPF12498bZIP_Ccoord: 169..294
e-value: 1.3E-39
score: 135.8

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0015984 ID=g.arboreum_cottongen_reftransV1_0015984|Name=g.arboreum_cottongen_reftransV1_0015984|organism=Gossypium arboreum|type=contig|length=908bp
CTTTTCTTAAGAACAAGCTTAACTTGGCTTGTGCTGCTGTTGCCATGTCA
AGGGCATCTTTTGTAAAACCGCAAGATTCGGCTGTTAGAGCTGACAGCGG
ATCACAGGCATCCGATACTCCCCAATCGGGATCCATAGCTACTTCTAAAG
GGGCTGGTGATAAGGACGGTAATGCACAGTCGGGATTTCCTTCAGTGGTT
AATGGACAAAAGAAGATTGGAGCTCAGGTGAGGCCAAGCACAAGTGGATC
ATCAAGAGAGATGTCGGAAGATGATGAAGTAGAAGGAGAGAACGAAACAA
TGGAGAACATGGATCCAGCTGATGCAAAACGTGTAAGGAGGATGCTTTCC
AATAGAGAGTCCGCTAGGCGCTCTAGAAGAAGAAAGCAGGCTCATTTGAC
GGAACTCGAGACACAGGTTTCTCAACTAAGAGTCGAAAATGCAACCTTAT
TGAAGCGTCTTACTGACATTAGCCAAAAGTACAATGAATCAGCGGTCGAC
AATAGAGTTCTGAAAGCTGATGTTGAAACATTGAGAGCAAAGGTGAAAAT
GGCTGAAGATTCCGTCAAAAGAATAACCGGTTTGAGCCCTGTGTTCCATG
CCTCACCCGAAATATCGACAGCGGGGATGTCATCATTCGATGGAAGTCCC
TCCGATACATCTACCGAAGCTGCTGTTTCCGTACAAGACGGCCCAAAGCA
TCCCTTATATCAGGCTGCTGCAAACAAACCTATATCTACTCATGACCTGA
GAACCAATAACGCGCTTGCGGATATATCTTCAGTCGAAAACATACAACCG
AAGTCAGAAGTATCATCAGTATCAGGAAACAAAATCGGTCGGACACCTTC
TATGCAGCGAGTGGCTAGCTTGGAGCATCTGCAAAAGCGGATATGCGGGG
GCATAAGC
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR004827bZIP
IPR020983Basic_leucine-zipper_C
Vocabulary: Molecular Function
TermDefinition
GO:0003700sequence-specific DNA binding transcription factor activity
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-dependent