g.arboreum_cottongen_reftransV1_0001670, g.arboreum_cottongen_reftransV1_0001670 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001670
Unique Nameg.arboreum_cottongen_reftransV1_0001670
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1129
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr7chromosomeg.arboreum_cottongen_reftransV1_0001670:1..1129 .
Chr7:14098541..14100197 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A0B0PIB6_GOSAR (Tyrosyl-DNA phosphodiesterase 2 OS=Gossypium arboreum GN=F383_07699 PE=4 SV=1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 312/312 (100.00%), Postives = 312/312 (100.00%), Query Frame = -1
Query:  194 RKIREPNLGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1129
            RKIREPNLGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRKEKKLLELPVLPSDHYGLLLTISSQ
Sbjct:   94 RKIREPNLGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRKEKKLLELPVLPSDHYGLLLTISSQ 405          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A0D2SYV2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_010G252100 PE=4 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 305/312 (97.76%), Postives = 309/312 (99.04%), Query Frame = -1
Query:  194 RKIREPNLGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1129
            RKIREPNLGNEDCIELGGFRGIKASNKAVQIE S+SGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISD+TASLRAYFCIQLSK PVKSFRREPFDNSIMGRELCMTEVE+SGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILEN PNVIFGGDMNWDDKLDG+FPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRKEKKLLELPVLPSDHYGLLLTISSQ
Sbjct:  135 RKIREPNLGNEDCIELGGFRGIKASNKAVQIEDSHSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDNTASLRAYFCIQLSKLPVKSFRREPFDNSIMGRELCMTEVEVSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENNPNVIFGGDMNWDDKLDGRFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRKEKKLLELPVLPSDHYGLLLTISSQ 446          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A061GNQ8_THECC (Endonuclease/exonuclease/phosphatase family protein OS=Theobroma cacao GN=TCM_030246 PE=4 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 3.109e-173
Identity = 249/313 (79.55%), Postives = 278/313 (88.82%), Query Frame = -1
Query:  194 RKIREPNLGNEDCIELGGFRGIKASNKAVQIE-GSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1129
            RKIR P++GNEDC+E   FRGIKASNKAV +E  SN G++++SLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPD+ICFQEVTP IYDIFR SNWW  YRCS+S D A+ R YFC+QLSK PVKSF  +PF NS+MGRELCMTEVE+ GG++ LVVAT+HLESP PAPPKWDQM+SKERVEQAK AINIL+N P+VIFGGDMNWDDKLDGQFPL DGWIDAW ELR AEDGWTYDTKSNQMLS NRTL+KRLDRF+C LN FKV  ++MIG+E +PGLSY KEKNVRKEKKLLELPVLPSDHYGLLLTIS++
Sbjct:  136 RKIRYPDVGNEDCLESSSFRGIKASNKAVAVEEDSNLGAVESSLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDLICFQEVTPNIYDIFRQSNWWNVYRCSVSVDMANSRGYFCMQLSKRPVKSFSCKPFGNSVMGRELCMTEVEVFGGKS-LVVATSHLESPSPAPPKWDQMFSKERVEQAKEAINILKNNPDVIFGGDMNWDDKLDGQFPLPDGWIDAWRELRSAEDGWTYDTKSNQMLSGNRTLQKRLDRFVCNLNDFKVSGIDMIGIEALPGLSYIKEKNVRKEKKLLELPVLPSDHYGLLLTISTK 447          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A067GEZ3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012811mg PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 1.260e-144
Identity = 215/321 (66.98%), Postives = 247/321 (76.95%), Query Frame = -1
Query:  194 RKIREPNLGNEDCIELGGFRGIKASNKAV---------QIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1129
            RKIR+     +DC   G F G + +N              + S SG++  SLKILSYNVWFREDLE+H RMK IGDLIQLHSPDIICFQE+TP IYDI   S+WWKGYRCS+ ++ A  R YFC+QLSK   KSF  EPF NSIMGRELC+ EVE+ G +  LVVAT+HLESPCP PP WDQM+SKERVEQAK AIN+L+  PNVIF GDMNWDDKLDG+FPL DGW+DAW ELRP E+GWTYDTKSN+MLS NRTL+KRLDRF+C L  FK+  ++MIGVE IPGL Y KEK VRKE + LELPVLPSDHYGLLLTIS+ 
Sbjct:  142 RKIRD-----QDCD--GDFDGFRVTNSVSIKDDTTSGPSADNSESGAVSGSLKILSYNVWFREDLEMHPRMKTIGDLIQLHSPDIICFQEITPNIYDILCKSSWWKGYRCSVPNEMADSRGYFCMQLSKLQAKSFTCEPFRNSIMGRELCVAEVEVQG-KKPLVVATSHLESPCPGPPTWDQMFSKERVEQAKEAINLLKKNPNVIFCGDMNWDDKLDGKFPLPDGWVDAWTELRPGENGWTYDTKSNKMLSGNRTLQKRLDRFICSLRDFKIIRIDMIGVEAIPGLLYVKEKKVRKEMQKLELPVLPSDHYGLLLTISNN 454          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A067GF93_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012811mg PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 8.076e-144
Identity = 205/281 (72.95%), Postives = 233/281 (82.92%), Query Frame = -1
Query:  194 EGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1036
            + S SG++  SLKILSYNVWFREDLE+H RMK IGDLIQLHSPDIICFQE+TP IYDI   S+WWKGYRCS+ ++ A  R YFC+QLSK   KSF  EPF NSIMGRELC+ EVE+ G +  LVVAT+HLESPCP PP WDQM+SKERVEQAK AIN+L+  PNVIF GDMNWDDKLDG+FPL DGW+DAW ELRP E+GWTYDTKSN+MLS NRTL+KRLDRF+C L  FK+  ++MIGVE IPGL Y KEK VRKE + LELPVLPSDHYGLLLTIS+ 
Sbjct:  149 DNSESGAVSGSLKILSYNVWFREDLEMHPRMKTIGDLIQLHSPDIICFQEITPNIYDILCKSSWWKGYRCSVPNEMADSRGYFCMQLSKLQAKSFTCEPFRNSIMGRELCVAEVEVQG-KKPLVVATSHLESPCPGPPTWDQMFSKERVEQAKEAINLLKKNPNVIFCGDMNWDDKLDGKFPLPDGWVDAWTELRPGENGWTYDTKSNKMLSGNRTLQKRLDRFICSLRDFKIIRIDMIGVEAIPGLLYVKEKKVRKEMQKLELPVLPSDHYGLLLTISNN 428          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: I1KNE7_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=2)

HSP 1 Score: 426.017 bits (1094), Expect = 2.883e-143
Identity = 199/291 (68.38%), Postives = 240/291 (82.47%), Query Frame = -1
Query:  194 IKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1066
            +K S+KA  I G  +     + KILSYNVWFREDLE+HKRMKAIGDL+Q HSPD ICFQEVTP IYDIF+ S WW GYRCS+S +    R YFC+ LSK PVKSF ++PF NSIMGRELC+ EVE + G T+LV+AT+HLESP P PPKWDQM+SKERV QA  AIN+L+ +PNV+FGGDMNW+D LDGQ+PL DGW+DAW++LRP E+GWTYDTK+NQML+ NRT++KRLDRF+C+L  FK+ +V+MIG+E IPG+SY KEK VRKE K L LP+LPSDHYGLLLTISS+
Sbjct:  143 VKPSDKATDITGDENIDSGKAFKILSYNVWFREDLELHKRMKAIGDLVQFHSPDFICFQEVTPNIYDIFKRSTWWSGYRCSVSSEMDYSRPYFCMVLSKLPVKSFSKKPFSNSIMGRELCIAEVEAARG-TSLVIATSHLESPSPGPPKWDQMFSKERVVQANEAINLLKKQPNVVFGGDMNWNDNLDGQYPLQDGWVDAWSQLRPNENGWTYDTKANQMLTGNRTVQKRLDRFICRLTDFKITSVDMIGMEAIPGVSYNKEKKVRKEIKQLVLPILPSDHYGLLLTISSK 432          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A0B2RMI0_GLYSO (Tyrosyl-DNA phosphodiesterase 2 OS=Glycine soja GN=glysoja_039517 PE=4 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 3.077e-143
Identity = 199/291 (68.38%), Postives = 240/291 (82.47%), Query Frame = -1
Query:  194 IKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1066
            +K S+KA  I G  +     + KILSYNVWFREDLE+HKRMKAIGDL+Q HSPD ICFQEVTP IYDIF+ S WW GYRCS+S +    R YFC+ LSK PVKSF ++PF NSIMGRELC+ EVE + G T+LV+AT+HLESP P PPKWDQM+SKERV QA  AIN+L+ +PNV+FGGDMNW+D LDGQ+PL DGW+DAW++LRP E+GWTYDTK+NQML+ NRT++KRLDRF+C+L  FK+ +V+MIG+E IPG+SY KEK VRKE K L LP+LPSDHYGLLLTISS+
Sbjct:  114 VKPSDKATDITGDENIDSGKAFKILSYNVWFREDLELHKRMKAIGDLVQFHSPDFICFQEVTPNIYDIFKRSTWWSGYRCSVSSEMDYSRPYFCMVLSKLPVKSFSKKPFSNSIMGRELCIAEVEAARG-TSLVIATSHLESPSPGPPKWDQMFSKERVVQANEAINLLKKQPNVVFGGDMNWNDNLDGQYPLQDGWVDAWSQLRPNENGWTYDTKANQMLTGNRTVQKRLDRFICRLTDFKITSVDMIGMEAIPGVSYNKEKKVRKEIKQLVLPILPSDHYGLLLTISSK 403          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: B9NBH8_POPTR (Endonuclease/exonuclease/phosphatase family protein OS=Populus trichocarpa GN=POPTR_0004s01100g PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 3.801e-143
Identity = 209/299 (69.90%), Postives = 250/299 (83.61%), Query Frame = -1
Query:  200 IELGGFRGIKASNKAVQI--EGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTIS 1090
            ++LG F+G +ASNK V +  E +NS ++  S KILSYNVWFREDLE+H+RMKA+G+LIQLHSPD+IC QEV P IYDIF+ S+WWK Y+CS+S + AS R YFC+QLSK PVKSF  +PF NSIMGRELC+ E+E+ G + +LVVAT+HLESPCPAPPKWDQM+SKERV+QAK AIN+L+   NVIF GDMNWDDKLDGQFP  DGW+DAW EL+P ++GWTYDTKSNQMLS NR L+KRLDRF+C L  FK+  ++MIG + IPGLSY KEK VRKE K+LELPVLPSDHYGLLLTIS
Sbjct:  123 VKLGAFQGARASNKGVAVLTEDTNSAAVLGSFKILSYNVWFREDLEMHRRMKALGELIQLHSPDVICLQEVIPDIYDIFQRSSWWKAYQCSVSSEIASSRGYFCMQLSKLPVKSFSTKPFMNSIMGRELCIAELEVPG-KKSLVVATSHLESPCPAPPKWDQMFSKERVDQAKEAINLLKKNSNVIFCGDMNWDDKLDGQFPFPDGWVDAWVELKPGDNGWTYDTKSNQMLSGNRALQKRLDRFICSLCDFKISKIDMIGKDAIPGLSYMKEKKVRKEVKMLELPVLPSDHYGLLLTIS 420          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: I1MR47_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 4.557e-142
Identity = 204/305 (66.89%), Postives = 245/305 (80.33%), Query Frame = -1
Query:  194 LGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1108
            + ++D  E+  F+ +K SN    I G  +     + KILSYNVWFREDLE+HKRMKAIGDL+QLHSPD ICFQEVTP IYDIF+GS WW  Y CS+S + A  R YFC+ LSK PVKSF  +PF NSIMGRELC+ EVE + G+  LV+AT+HLESPCPAPPKWDQMYSKERV QA  AIN+L+ +P+V+FGGDMNW+D+ DGQ+PL DGW+DAW++LRP E GWTYDTKSNQML+ NRTL+KRLDRF+C+   FK+ +V+MIG+E IPG+SY KEK VRKE K L LPVLPSDHYGLLLTISS+
Sbjct:  104 IDDDDSSEVINFK-VKPSN----ITGDENIDTGKAFKILSYNVWFREDLELHKRMKAIGDLVQLHSPDFICFQEVTPNIYDIFKGSAWWSVYCCSVSSEMAYSRPYFCMLLSKLPVKSFSNKPFSNSIMGRELCIAEVEAASGKP-LVIATSHLESPCPAPPKWDQMYSKERVVQANEAINLLKKQPSVVFGGDMNWNDQQDGQYPLQDGWVDAWSQLRPNESGWTYDTKSNQMLTGNRTLQKRLDRFICQFTDFKITSVDMIGMEAIPGVSYNKEKKVRKEIKQLVLPVLPSDHYGLLLTISSK 402          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Match: A0A0B2P2A3_GLYSO (Tyrosyl-DNA phosphodiesterase 2 OS=Glycine soja GN=glysoja_004512 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 4.557e-142
Identity = 204/305 (66.89%), Postives = 245/305 (80.33%), Query Frame = -1
Query:  194 LGNEDCIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPNVIFGGDMNWDDKLDGQFPLTDGWIDAWNELRPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISSQ 1108
            + ++D  E+  F+ +K SN    I G  +     + KILSYNVWFREDLE+HKRMKAIGDL+QLHSPD ICFQEVTP IYDIF+GS WW  Y CS+S + A  R YFC+ LSK PVKSF  +PF NSIMGRELC+ EVE + G+  LV+AT+HLESPCPAPPKWDQMYSKERV QA  AIN+L+ +P+V+FGGDMNW+D+ DGQ+PL DGW+DAW++LRP E GWTYDTKSNQML+ NRTL+KRLDRF+C+   FK+ +V+MIG+E IPG+SY KEK VRKE K L LPVLPSDHYGLLLTISS+
Sbjct:  104 IDDDDSSEVINFK-VKPSN----ITGDENIDTGKAFKILSYNVWFREDLELHKRMKAIGDLVQLHSPDFICFQEVTPNIYDIFKGSAWWSVYCCSVSSEMAYSRPYFCMLLSKLPVKSFSNKPFSNSIMGRELCIAEVEAASGKP-LVIATSHLESPCPAPPKWDQMYSKERVVQANEAINLLKKQPSVVFGGDMNWNDQQDGQYPLQDGWVDAWSQLRPNESGWTYDTKSNQMLTGNRTLQKRLDRFICQFTDFKITSVDMIGMEAIPGVSYNKEKKVRKEIKQLVLPVLPSDHYGLLLTISSK 402          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_XENTR (Tyrosyl-DNA phosphodiesterase 2 OS=Xenopus tropicalis GN=tdp2 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.113e-18
Identity = 86/310 (27.74%), Postives = 144/310 (46.45%), Query Frame = -1
Query:  212 GNEDCIELGGFRGIKASNKAVQIEGSNSGSIK----ASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKP---NVIFGGDMNWDDKLDGQF-PLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCAVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLL 1105
             ++ CI+L G   +   ++A     SNS ++K    +    L++N+   ++  V +R + +   + L+SPD++  QEV P  Y+      + K    S +  T +   YF  + L K  VK   +E  P+ +++M R L +  V +SG    L+  T+HLES         + +SKER++Q  + +  + + P    VIFGGD N  D+   +   + +  +D W+ L +P    +T+DTK N+ L A    R R DR   +            G + IP   Y          + L+    PSDH+GLL
Sbjct:   90 ASDSCIDLTGDDLVVTKSEATT---SNSSTVKQEDESHFSFLTWNIDGLDESNVAERARGVCSYLALYSPDVVFLQEVIPPYYE------YLKKRAVSYTIITGNEDEYFTAMMLKKSRVKLISQEIVPYPSTVMMRNLLVANVNISGNSICLM--TSHLEST--------KDHSKERLKQLDIVLKKMMDAPPLATVIFGGDTNLRDQEVAKIGGMPNNILDVWDFLGKPEHCRYTWDTKVNKNLRAPYICRLRFDRIFFR--------ASQEGSQVIPQSLYL------AGTEKLDCGRFPSDHWGLL 366          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_XENLA (Tyrosyl-DNA phosphodiesterase 2 OS=Xenopus laevis GN=tdp2 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.487e-17
Identity = 87/316 (27.53%), Postives = 145/316 (45.89%), Query Frame = -1
Query:  212 LGNEDCIELGGFRGIKASNKAVQIEGSNSGSIK-----ASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKP---NVIFGGDMNWDDKLDGQF-PLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDRFL--CKLNGFKVCA--VEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLL 1108
            + ++ CI+L     +   ++AV    SNS ++K     +    L++N+   ++  V +R +A+   + L++PD++  QEV P   +      + K    S    T +   YF  + L K  VK   +E  P+ +++M R L +  V +SG    L+  T+HLES         + +SKER++Q    +  + + P    VIFGGD N  D+   +   L +  +D W  L +P    +T+DTK N  L A  T R R DR L    + G +V    + ++G E +    +                  PSDH+GLL
Sbjct:   86 VTSDACIDLTSDDLVATKSEAVT---SNSSTVKQQEDESHFTFLTWNIDGLDESNVAERARAVCSCLALYTPDVVFLQEVIPPYCE------YLKKRAVSYKIITGNEDEYFTAMMLKKSRVKLISQEIVPYPSTLMMRNLLVANVNISGNSICLM--TSHLEST--------KDHSKERLKQLDTVLKKMMDAPPSATVIFGGDTNLRDQEVAKIGGLPNTILDVWEFLGKPEHCRYTWDTKLNNNLRACYTSRLRFDRILYRASMEGSQVIPQFLNLVGTEKLDCGRF------------------PSDHWGLL 364          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_MOUSE (Tyrosyl-DNA phosphodiesterase 2 OS=Mus musculus GN=Tdp2 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.952e-17
Identity = 85/302 (28.15%), Postives = 132/302 (43.71%), Query Frame = -1
Query:  200 SNKAVQIEGSNSGSIKASLKILSYNVWFREDLE---VHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPN---VIFGGDMNWDD----KLDGQFPLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVC--AVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTIS 1057
            +N    +E S SG+       +S+  W  + L+   + +R + +   + L+SPD++  QEV P          + K    S +  T +   YF  I L K  VK   +E  PF N+ M R L    V L G E  L+  T+HLES         + +S ER+ Q K  +  ++  P+   VIF GD N  D    K  G   L D   DAW  L +P    +T+DTK+N  L      + R DR   +     +   +++++G+E +    +                  PSDH+GLL T++
Sbjct:  103 ANDTTILEASPSGTPLEDSSTISFITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPPY------CAYLKKRAASYTIITGNEEGYFTAILLKKGRVKFKSQEIIPFPNTKMMRNLLCVNVSLGGNEFCLM--TSHLES--------TREHSAERIRQLKTVLGKMQEAPDSTTVIFAGDTNLRDQEVIKCGG---LPDNVFDAWEFLGKPKHCQYTWDTKANNNLRIPAAYKHRFDRIFFRAEEGHLIPQSLDLVGLEKLDCGRF------------------PSDHWGLLCTLN 367          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_BOVIN (Tyrosyl-DNA phosphodiesterase 2 OS=Bos taurus GN=TDP2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.587e-15
Identity = 79/280 (28.21%), Postives = 125/280 (44.64%), Query Frame = -1
Query:  203 ILSYNVWFREDLEVH---KRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKP---NVIFGGDMNW-DDKLDGQFPLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDR--FLCKLNGFKVC--AVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTI 997
            + S+  W  + L+++   +R + +   + L+SPD+I  QEV P  Y       + K    S    T     YF  I L K  VK   +E  PF N+ M R L    V +SG E  L + T+HLES         + ++KER+ Q K+ +  ++  P    VIF GD N  D ++     L +  +D W  L +P    +T+DT+ N  L      + R DR  F     G  +   +++++G+E +    +                  PSDH+GLL T+
Sbjct:  115 VFSFITWNIDGLDMNNLLERARGVCSYLTLYSPDVIFLQEVIPPYY------AYLKKKASSYKIITGREEGYFTAIMLKKSRVKFKSQEIIPFPNTQMMRNLLCVHVSVSGNE--LCLMTSHLEST--------RGHAKERMNQFKMVLEKMQEAPGSATVIFAGDTNLRDQEVTKCGGLPNNILDVWEFLGKPKHCQYTWDTQMNSNLGIAANCKLRFDRIFFRAAAEGGHIIPQSLDLLGLEKLDCGRF------------------PSDHWGLLCTL 360          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_RAT (Tyrosyl-DNA phosphodiesterase 2 OS=Rattus norvegicus GN=Tdp2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.483e-15
Identity = 86/302 (28.48%), Postives = 131/302 (43.38%), Query Frame = -1
Query:  200 SNKAVQIEGSNSGSIKASLKILSYNVWFREDLE---VHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILE---NKPNVIFGGDMNWDD----KLDGQFPLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVC--AVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTIS 1057
            +N    +E S SG+       +S+  W  + L+   + +R + +   + L+SPD++  QEV P      R     K  R + +  T +   YF  I L K  VK   +E  PF N+ M R L    V L G E  L+  T+HLES         + +S ER+ Q K     ++   +   VIF GD N  D    K  G   L D   DAW  L +P    +T+DTK+N  L      + R DR   +     +   ++++IG+E +    +                  PSDH+GLL T++
Sbjct:   99 ANDTTILETSPSGTPLEDSSTISFITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPSYCAYLR-----KRAR-TYNIITGNEEGYFTAILLKKGRVKFKGQEIIPFPNTKMMRNLLCVNVSLGGNEFCLM--TSHLEST--------RKHSAERINQLKTVFQKMQEATDSTTVIFAGDTNLRDQEVIKCGG---LPDNVFDAWEFLGKPKHCRYTWDTKANDNLRIPAACKHRFDRIFFRAEEGHLIPQSLDLIGLERLDCGRF------------------PSDHWGLLCTLN 363          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_CHICK (Tyrosyl-DNA phosphodiesterase 2 OS=Gallus gallus GN=TDP2 PE=3 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 7.027e-14
Identity = 86/309 (27.83%), Postives = 135/309 (43.69%), Query Frame = -1
Query:  212 CIELGGFRGIKASNKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSKFP-VKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKP---NVIFGGDMNWDD----KLDGQFPLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDR--FLCKLNGFKVCA--VEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLL 1093
            CI+L       ASN +     S      +S  ++++N+   +   + +R + +   + L+SPD++  QEV P    I +      GY         ++  YF   L K P VK  ++E   F  + M R L +  V +SG E  L + T+HLES         + +SKER++Q ++ +N ++ +     VIFGGD N  D    KL G   L     D W  L +P    +T+DT SN  L      + R DR  F     G  +    +++IG+E +    +                  PSDH+GLL
Sbjct:   93 CIDLTA--DDTASNTSSSGADSKQQDDDSSFSLITWNIDGLDLGNLQERARGVCSYLALYSPDVVFLQEVIPPYLCILQ--RRAGGYTII----PGNVDGYFTAMLLKKPRVKVLKQEIIRFPTTSMMRNLLVVHVNISGNE--LCLMTSHLEST--------RDHSKERMKQLQIVLNKMQEESQSTTVIFGGDTNLRDSEVAKLGG---LPKNITDIWEFLGKPQHCRYTWDTSSNTNLRIESKCKLRFDRLYFRPAAEGGHIIPRNMDLIGLEKLDCGRF------------------PSDHWGLL 362          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_HUMAN (Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens GN=TDP2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 5.489e-13
Identity = 74/271 (27.31%), Postives = 115/271 (42.44%), Query Frame = -1
Query:  203 VHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIF--RGSNWWKGYRCSISDDTASLRAYF-CIQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKP---NVIFGGDMNWDDK-LDGQFPLTDGWIDAWNEL-RPAEDGWTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVCA---------VEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTI 958
            + +R + +   + L+SPD+I  QEV P  Y     R SN+           T     YF  I L K  VK   +E  PF ++ M R L    V +SG E  L + T+HLES         + ++ ER+ Q K+ +  ++  P    VIF GD N  D+ +     L +  +D W  L +P    +T+DT+ N  L      + R DR       F+  A         ++++G+E +    +                  PSDH+GLL  +
Sbjct:  129 LSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNY--------EIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNE--LCLMTSHLES--------TRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIF-----FRAAAEEGHIIPRSLDLLGLEKLDCGRF------------------PSDHWGLLCNL 358          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_DANRE (Tyrosyl-DNA phosphodiesterase 2 OS=Danio rerio GN=tdp2 PE=1 SV=3)

HSP 1 Score: 72.4034 bits (176), Expect = 1.187e-12
Identity = 89/325 (27.38%), Postives = 139/325 (42.77%), Query Frame = -1
Query:  197 NEDCIELGGFR---GIKASNKAVQIE-GSNSGSIKAS-LKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPMIYDIFRGSN----WWKGYRCSISDDTASLRAYFC-IQLSKFPVKSFRRE--PFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAINILENKPN---VIFGGDMNW-DDKLDGQFPLTDGWIDAWNELRPAEDG-WTYDTKSNQMLSANRTLRKRLDRFLCKLNGFKVC------AVEMIGVEPIPGLSYTKEKNVRXXXXXXXLPVLPSDHYGLLLTISS 1102
            N DCI+L        I  ++K  Q E G+    ++ S L I+S+NV   + L +  R + +   + L++PD++  QE+ P      +       +++G     SDD      YF  I L K  VK    E   F  + M R L + +V  SG +  L + T+HLES         +  S+ER +Q +V +  ++  P    VIF GD N  D ++     L  G  D W +L   E   +T+DTK+N   +     R R DR    L   K         + +IG+E +    YT                  SDH+G+  T ++
Sbjct:   85 NADCIDLTAEEPTCSITVNSKENQAENGTAKSEVEDSKLSIISWNVDGLDTLNLADRARGLCSYLALYTPDVVFLQELIPAYVQYLKKRAVSYLFFEG-----SDD-----GYFTGIMLRKSRVKFLESEIICFPTTQMMRNLLIAQVTFSGQK--LYLMTSHLESC--------KNQSQERTKQLRVVLQKIKEAPEDAIVIFAGDTNLRDAEVANVGGLPAGVCDVWEQLGKQEHCRYTWDTKANSNKTVPYVSRCRFDRIF--LRSAKTAPPVTPDHMALIGMEKLDCGRYT------------------SDHWGIYCTFNT 369          
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Match: TYDP2_CAEBR (5'-tyrosyl-DNA phosphodiesterase OS=Caenorhabditis briggsae GN=CBG18823 PE=3 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 7.989e-9
Identity = 67/238 (28.15%), Postives = 107/238 (44.96%), Query Frame = -1
Query:  368 NKAVQIEGSNSGSIKASLKILSYNVWFREDLEVHKRMKAIGDLIQLHSPDIICFQEVTPM-IYDIFRGSNWWKGYRCSISDDTASLRAYFCIQLSK-FPVKSFRREPFDNSIMGRELCMTEVELSGGETTLVVATTHLESPCPAPPKWDQMYSKERVEQAKVAIN----ILENKPN--VIFGGDMNWDDKLDGQFPLTDGWIDAWNELR-PAEDGWTYDTKSNQMLSANRTLRKRLDR 1054
            N+AV    S++G     L ++S+N+   +   +  RMKA+  +++  +PDI+  QEV    +  I +  + +K Y  +        + Y  I +SK F V+      F NS M R L + E  + G +  LV   THLES         + +  +R+ Q    ++    I+ N P   + FGGD+N  D+     P  DG +DAW       +  WT+DT  N         + R DR
Sbjct:   80 NEAVMGPSSSAG---FELSLMSWNIDGLDGRSLATRMKAVATIVKKVNPDILFLQEVVDRDLEPIDKLQSLYKIYYSN-----KGCQYYTAILVSKMFEVEKHDVVHFQNSGMYRTLQIVEGSIGGMKVFLV--NTHLESM--------RDHRAQRMAQFSFCMDRCAEIIANNPGCFLFFGGDLNLRDEEISSIP--DGVLDAWVSAGCDTKTKWTWDTYKNDNKQGFNGAKMRFDR 297          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PIB6_GOSAR0.000e+0100.00Tyrosyl-DNA phosphodiesterase 2 OS=Gossypium arbor... [more]
A0A0D2SYV2_GOSRA0.000e+097.76Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GNQ8_THECC3.109e-17379.55Endonuclease/exonuclease/phosphatase family protei... [more]
A0A067GEZ3_CITSI1.260e-14466.98Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067GF93_CITSI8.076e-14472.95Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
I1KNE7_SOYBN2.883e-14368.38Uncharacterized protein OS=Glycine max PE=4 SV=2[more]
A0A0B2RMI0_GLYSO3.077e-14368.38Tyrosyl-DNA phosphodiesterase 2 OS=Glycine soja GN... [more]
B9NBH8_POPTR3.801e-14369.90Endonuclease/exonuclease/phosphatase family protei... [more]
I1MR47_SOYBN4.557e-14266.89Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
A0A0B2P2A3_GLYSO4.557e-14266.89Tyrosyl-DNA phosphodiesterase 2 OS=Glycine soja GN... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001670 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
TYDP2_XENTR1.113e-1827.74Tyrosyl-DNA phosphodiesterase 2 OS=Xenopus tropica... [more]
TYDP2_XENLA1.487e-1727.53Tyrosyl-DNA phosphodiesterase 2 OS=Xenopus laevis ... [more]
TYDP2_MOUSE1.952e-1728.15Tyrosyl-DNA phosphodiesterase 2 OS=Mus musculus GN... [more]
TYDP2_BOVIN1.587e-1528.21Tyrosyl-DNA phosphodiesterase 2 OS=Bos taurus GN=T... [more]
TYDP2_RAT5.483e-1528.48Tyrosyl-DNA phosphodiesterase 2 OS=Rattus norvegic... [more]
TYDP2_CHICK7.027e-1427.83Tyrosyl-DNA phosphodiesterase 2 OS=Gallus gallus G... [more]
TYDP2_HUMAN5.489e-1327.31Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens GN... [more]
TYDP2_DANRE1.187e-1227.38Tyrosyl-DNA phosphodiesterase 2 OS=Danio rerio GN=... [more]
TYDP2_CAEBR7.989e-928.155'-tyrosyl-DNA phosphodiesterase OS=Caenorhabditis... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005135Endonuclease/exonuclease/phosphataseGENE3D3.60.10.10coord: 33..302
e-value: 1.4E-14
score: 53.7
IPR005135Endonuclease/exonuclease/phosphatasePFAMPF03372Exo_endo_phoscoord: 39..295
e-value: 2.8E-19
score: 69.8
IPR005135Endonuclease/exonuclease/phosphataseSUPERFAMILY56219DNase I-likecoord: 35..302
NoneNo IPR availablePANTHERPTHR15822:SF4TYROSYL-DNA PHOSPHODIESTERASE 2coord: 18..305
NoneNo IPR availablePANTHERPTHR15822TRAF AND TNF RECEPTOR-ASSOCIATED PROTEINcoord: 18..305

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001670 ID=g.arboreum_cottongen_reftransV1_0001670|Name=g.arboreum_cottongen_reftransV1_0001670|organism=Gossypium arboreum|type=contig|length=1129bp
GACAAAATGATCATATGATTTCCATACATGGAAGTTTTCATACAAAAAAA
GCTAAATGCTGCAAACCATTCGCATCATAGTCCGTTACTAGTCTATACAA
AATCGGCATACGAGTATGACCGCAAATACGGATGAAAATAGACGAACAAT
TCGAGCTTAAACCGAACCATATATGATGCCAGACCGGGCATTACTGACTT
GAGATTGTTAAAAGCAAGCCATAATGATCACTTGGCAAAACAGGAAGTTC
CAATAACTTCTTCTCTTTCCTCACATTCTTCTCCTTGGTATATGATAAAC
CCGGTATTGGCTCTACCCCGATCATCTCGACTGCACAGACTTTAAAACCA
TTCAGCTTGCATAGAAAGCGATCTAGTCGTTTTCGTAATGTACGATTTGC
CGATAACATCTGGTTTGATTTGGTATCATACGTCCATCCATCTTCAGCAG
GCCTTAACTCGTTCCAAGCATCAATCCATCCATCAGTTAAAGGAAACTGA
CCATCTAATTTGTCATCCCAATTCATATCACCACCAAAAATAACATTCGG
CTTATTCTCGAGAATATTGATCGCTACTTTCGCTTGTTCTACACGTTCCT
TACTATACATTTGATCCCATTTCGGCGGAGCAGGACACGGACTCTCGAGA
TGGGTAGTAGCAACAACAAGCGTTGTTTCACCCCCAGAAAGTTCAACCTC
AGTCATGCAAAGTTCTCGCCCCATTATCGAATTATCAAAAGGTTCACGAC
GAAAGGATTTCACAGGGAATTTGCTTAACTGTATACAAAAGTAAGCTCTC
AAACTCGCCGTGTCGTCTGAGATAGAGCACCGGTACCCTTTCCACCAGTT
AGACCCACGAAAAATGTCATAAATCATCGGAGTAACCTCTTGAAAACAAA
TGATATCAGGGGAATGAAGTTGAATAAGGTCACCAATAGCTTTCATCCTC
TTGTGAACCTCTAAATCTTCCCTAAACCAAACATTGTAGCTCAATATCTT
CAATGAAGCTTTAATGGATCCTGAATTACTACCCTCTATTTGAACAGCTT
TATTGGAGGCTTTAATGCCACGAAAACCACCCAATTCGATACAATCTTCA
TTACCCAGATTTGGTTCCCTGATCTTCCT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR005135Endo/exonuclease/phosphatase