g.arboreum_cottongen_reftransV1_0010582, g.arboreum_cottongen_reftransV1_0010582 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010582
Unique Nameg.arboreum_cottongen_reftransV1_0010582
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1363
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr9chromosomeg.arboreum_cottongen_reftransV1_0010582:1..1363 .
Chr9:30545207..30546569 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A0B0NLW2_GOSAR (Pentatricopeptide repeat-containing-like protein OS=Gossypium arboreum GN=F383_05089 PE=4 SV=1)

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW
Sbjct:  303 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 721          

HSP 2 Score: 122.479 bits (306), Expect = 1.481e-26
Identity = 75/281 (26.69%), Postives = 136/281 (48.40%), Query Frame = -2
Query:  619 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNV-------------------------------ISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE--LGEFTAKRVLELEPD 1362
            RL+FD+M  +D+V+W  MI GY +S+   +AL LF+E++   I  D+  +  ++SACA  G LD  K IH Y  +        +  AL+ MYA CG ++ A+ ++++M  +NV                               +SW+ MI+ +A       ALR F++++   + P+ VT + V+ AC++ G+++  + I     +++           ++D+  +   L  A  + E M  + NV+ W  +++A  IHG+    L  F   +   +EP+
Sbjct:  171 RLVFDKMSYRDIVAWRIMIDGYCQSELFDDALELFEEMKRANIEADKFVLSGILSACARAGNLDCGKAIHDYIIQKELVIDAHLRCALVTMYASCGCMDMAQQLYDQMKPKNVVVSTAMVSGYSRHGRVKDARLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHV-YADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMT-SRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPN 449          

HSP 3 Score: 98.9821 bits (245), Expect = 8.237e-19
Identity = 59/222 (26.58%), Postives = 112/222 (50.45%), Query Frame = -2
Query:  631 AESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLE 1296
            + S +P+ A  +++ L+  GI  D+     ++ A + +G L + K IH +  K+GF     +   L+ MY  CG L  AR VF+KM+ R++++W  MI+ +      ++AL  F++MK A +E +     G+L AC+ AG ++ G+ I   +I +  +   H     +V +      +  A ++ + M    NVV+  +++S    HG  +       +++E
Sbjct:   92 SRSSKPEFAFFVYQRLRNEGIPIDRFAFPPLLKAASRVGWLAEGKEIHGFGFKSGFHSDPFVQTGLMVMYVGCGRLPEARLVFDKMSYRDIVAWRIMIDGYCQSELFDDALELFEEMKRANIEADKFVLSGILSACARAGNLDCGKAIHDYIIQKELVIDAHLRCA-LVTMYASCGCMDMAQQLYDQMK-PKNVVVSTAMVSGYSRHGRVKDARLIFDQMVE 311          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A0D2T7B3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G264200 PE=4 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 403/419 (96.18%), Postives = 409/419 (97.61%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLF EL+ILGI PDQVTMLSVISACANLGVLDKAKW HVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWT MINAFAIHGDANNALRYFQKMKEA VEPNGVTFVGVLYACSHAGLVE+GRKIFASMINEHNITPKHEHYGCMVDL GRANLLREAVEIVETMPFA NVVIWGSLMSACQIHGETELGEFTA RVLELEPDHDGALVLLSNIYAKERKW+NVGDLRQLMKERGI KERG SRIELN+E+HEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREI+VRDRTRFHHYRDGVCSCRDYW
Sbjct:  303 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFNELEILGIGPDQVTMLSVISACANLGVLDKAKWKHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTSMINAFAIHGDANNALRYFQKMKEACVEPNGVTFVGVLYACSHAGLVEEGRKIFASMINEHNITPKHEHYGCMVDLFGRANLLREAVEIVETMPFASNVVIWGSLMSACQIHGETELGEFTATRVLELEPDHDGALVLLSNIYAKERKWKNVGDLRQLMKERGICKERGCSRIELNDEMHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIVVRDRTRFHHYRDGVCSCRDYW 721          

HSP 2 Score: 120.553 bits (301), Expect = 7.409e-26
Identity = 71/265 (26.79%), Postives = 131/265 (49.43%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNV-------------------------------ISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDG--RKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M  +D+V+W  MI GY +++   +AL LF+E++   I  D+  + S++SAC   G LD  K IH Y  +        +  AL+ MYA CG ++ A+ ++++M  +NV                               +SW+ MI+ +A       ALR F +++   + P+ VT + V+ AC++ G+++    + ++A   +++           ++D+  +   L  A  + E M  + NV+ W S+++A  IHG+ 
Sbjct:  171 RLVFDKMSYRDIVAWRVMIDGYCQNELFDDALELFEEMKRANIEADKFVLSSILSACGRAGNLDCGKAIHDYIIQKELVIDAHLRCALVTMYASCGCMDMAQQLYDQMIPKNVVVSTAMVSGYSRHGRVKDARLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFNELEILGIGPDQVTMLSVISACANLGVLDKAKWKHVYA---DKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMT-SRNVISWTSMINAFAIHGDA 431          

HSP 3 Score: 97.4413 bits (241), Expect = 2.620e-18
Identity = 58/222 (26.13%), Postives = 111/222 (50.00%), Query Frame = -2
Query:  631 AESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLE 1296
            + S +P+ A  +++ L+  GI  D+     ++ A + +G L + K IH +  K+GF     +   L+ MY  CG L  AR VF+KM+ R++++W  MI+ +  +   ++AL  F++MK A +E +      +L AC  AG ++ G+ I   +I +  +   H     +V +      +  A ++ + M    NVV+  +++S    HG  +       +++E
Sbjct:   92 SRSSKPEFAFFVYQRLRNEGIPIDRFAFPPLLKAASRVGWLAEGKEIHGFGFKSGFHSDPFVQTGLMVMYVGCGRLTEARLVFDKMSYRDIVAWRVMIDGYCQNELFDDALELFEEMKRANIEADKFVLSSILSACGRAGNLDCGKAIHDYIIQKELVIDAHLRCA-LVTMYASCGCMDMAQQLYDQM-IPKNVVVSTAMVSGYSRHGRVKDARLIFDQMVE 311          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A061EMY0_THECC (Pentatricopeptide repeat (PPR) superfamily protein OS=Theobroma cacao GN=TCM_020645 PE=4 SV=1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 367/419 (87.59%), Postives = 395/419 (94.27%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDLV WSAMISGYAESDQPQEALRLF ELQ LG+RPDQVTMLSVISACA+LGVL+KAKWIHVYADKNGFGG+L INNALIDM+AKCGSLERAR VFEKMT RNVISWT MINAFAIHGDANNAL +F KMKEA VEPNGVTFVGVLYACSHAGLV++G++IFASMINEH I PKHEHYGCMVDL GRANLLREA+EIVETMP APNVVIWGSLM+ACQIHGETELGEF AKR+LELEPDHDGALVLLSNIYAKE+KWQ+VG+LR LMKERGISKE+G SRIELNNEVHEFL+ADRNHKQA +IYEKL+EV+S+LKL GY PNT  VLVDLEEEEKREVVLWHSEKLALCYGLING KDSCIRIVKNLRVCEDCHTF+KLVSK+Y REI+VRDRTRFHHY+DG+CSC+DYW
Sbjct:  304 RLIFDQMVEKDLVCWSAMISGYAESDQPQEALRLFNELQSLGMRPDQVTMLSVISACAHLGVLEKAKWIHVYADKNGFGGALPINNALIDMHAKCGSLERARGVFEKMTRRNVISWTSMINAFAIHGDANNALSFFHKMKEAHVEPNGVTFVGVLYACSHAGLVDEGQRIFASMINEHKIAPKHEHYGCMVDLFGRANLLREALEIVETMPLAPNVVIWGSLMAACQIHGETELGEFAAKRLLELEPDHDGALVLLSNIYAKEKKWQDVGELRHLMKERGISKEKGCSRIELNNEVHEFLMADRNHKQADKIYEKLDEVISQLKLVGYFPNTRSVLVDLEEEEKREVVLWHSEKLALCYGLINGEKDSCIRIVKNLRVCEDCHTFMKLVSKLYGREIVVRDRTRFHHYKDGLCSCKDYW 722          

HSP 2 Score: 120.939 bits (302), Expect = 5.460e-26
Identity = 78/283 (27.56%), Postives = 135/283 (47.70%), Query Frame = -2
Query:  619 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLER-------------------------------ARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGR--KIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE--LGEFTAKRVLELEPD 1362
            R +FD+M  +D+V+WS MI GY  S    +AL LF+E++   I  D+  + S++SAC  +G L+  K IH Y  +        + +AL+ MYA CG +E                                AR +F++M  ++++ W+ MI+ +A       ALR F +++   + P+ VT + V+ AC+H G++E  +   ++A         P +     ++D+  +   L  A  + E M    NV+ W S+++A  IHG+    L  F   +   +EP+
Sbjct:  172 RSVFDKMSYRDIVAWSIMIDGYCLSGLFDDALELFEEMKRANIEVDKFILSSILSACGRVGNLNHGKAIHDYIIEKILVVDSHLQSALMTMYASCGCMEMAQKLFNQMAPKNLVVSTAMVSGYSRHRRIEDARLIFDQMVEKDLVCWSAMISGYAESDQPQEALRLFNELQSLGMRPDQVTMLSVISACAHLGVLEKAKWIHVYADKNGFGGALPIN---NALIDMHAKCGSLERARGVFEKMT-RRNVISWTSMINAFAIHGDANNALSFFHKMKEAHVEPN 450          

HSP 3 Score: 94.7449 bits (234), Expect = 1.738e-17
Identity = 59/223 (26.46%), Postives = 111/223 (49.78%), Query Frame = -2
Query:  631 AESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAP-NVVIWGSLMSACQIHGETELGEFTAKRVLE 1296
            + S +P+ AL +++ L+  GI+ D+ T   ++ A A +  L + K IH +  K G      +   L+ MY  CG +  AR+VF+KM+ R++++W+ MI+ + + G  ++AL  F++MK A +E +      +L AC   G +  G+ I   +I +  +   H     M  +      +  A ++   M  AP N+V+  +++S    H   E       +++E
Sbjct:   93 SRSSRPEFALFVYQRLRNEGIKIDRFTFPPLLKAVARVEGLAEGKEIHGFGFKLGLDSDPFVQTGLVGMYLACGRVLEARSVFDKMSYRDIVAWSIMIDGYCLSGLFDDALELFEEMKRANIEVDKFILSSILSACGRVGNLNHGKAIHDYIIEKILVVDSHLQSALMT-MYASCGCMEMAQKLFNQM--APKNLVVSTAMVSGYSRHRRIEDARLIFDQMVE 312          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: B9HUV1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s09620g PE=4 SV=2)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 335/419 (79.95%), Postives = 376/419 (89.74%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQM EKDLV WSAMISGYAESD+PQEAL LF E+Q+ GI+PDQVT+LSVISACA LGVLD+AKWIH+Y DKNG GG+L +NNALIDMYAKCG+L  AR VFEKM SRNVISWT MINAFAIHGDA+NAL++F +MK+  ++PNGVTFVGVLYACSHAGLVE+GR+ FASM NEHNITPKHEHYGCMVDL GRANLLR+A+E+VETMP APNVVIWGSLM+ACQIHGE ELGEF AK+VLELEPDHDGALV LSNIYAK+R+WQ+VG+LR LMK+RGISKERG SRIELNN+V+EF++AD+ HKQA +IYEKL+EVV  LKL GY PNT  VLVD+EEE K+EVVLWHSEKLALCYGL+   K SCIRIVKNLRVCEDCHTF+KLVSKVY  EIIVRDRTRFHHY+ GVCSC DYW
Sbjct:  303 RLIFDQMEEKDLVCWSAMISGYAESDKPQEALNLFSEMQVFGIKPDQVTILSVISACARLGVLDRAKWIHMYVDKNGLGGALPVNNALIDMYAKCGNLGAARGVFEKMQSRNVISWTSMINAFAIHGDASNALKFFYQMKDENIKPNGVTFVGVLYACSHAGLVEEGRRTFASMTNEHNITPKHEHYGCMVDLFGRANLLRDALELVETMPLAPNVVIWGSLMAACQIHGENELGEFAAKQVLELEPDHDGALVQLSNIYAKDRRWQDVGELRNLMKQRGISKERGCSRIELNNQVYEFVMADKKHKQADKIYEKLDEVVKELKLVGYTPNTRSVLVDVEEEGKKEVVLWHSEKLALCYGLMGEGKGSCIRIVKNLRVCEDCHTFIKLVSKVYGMEIIVRDRTRFHHYKAGVCSCNDYW 721          

HSP 2 Score: 124.79 bits (312), Expect = 2.719e-27
Identity = 72/263 (27.38%), Postives = 134/263 (50.95%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRN-------------------------------VISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M  +D+V+WS MI GY +S    + L+LF+E++   ++PD++ + ++ISAC     L   + IH +  +N F     + +AL+ MYA CG +E A+ +F K++SRN                               ++ W+ MI+ +A       AL  F +M+   ++P+ VT + V+ AC+  G+++  + I    ++++ +         ++D+  +   L  A  + E M  + NV+ W S+++A  IHG+ 
Sbjct:  171 RLVFDKMSYRDVVAWSIMIDGYHQSGLYDDVLQLFEEMRSSNLKPDEMVLTTIISACGRARNLSYGEAIHDFIIENNFVLDTYLQSALLTMYASCGCMEMAQKLFTKISSRNLVVLTAMISGYSRVGRVEDARLIFDQMEEKDLVCWSAMISGYAESDKPQEALNLFSEMQVFGIKPDQVTILSVISACARLGVLDRAKWIHM-YVDKNGLGGALPVNNALIDMYAKCGNLGAARGVFEKMQ-SRNVISWTSMINAFAIHGDA 431          

HSP 3 Score: 79.7221 bits (195), Expect = 1.385e-12
Identity = 43/152 (28.29%), Postives = 84/152 (55.26%), Query Frame = -2
Query:  853 AESDQPQEALRLFKELQI----LGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKI 1296
            + S +P+ AL  ++++++    LGI  D+ +   ++ A +    L++ K IH  A K GF     +   L+ MYA C  +  AR VF+KM+ R+V++W+ MI+ +   G  ++ L+ F++M+ + ++P+ +    ++ AC  A  +  G  I
Sbjct:   90 SRSAKPETALLAYEKIRLKEGLLGI--DRFSFPPLLKAASRASGLNEGKEIHGVATKLGFDKDPFVQTGLVGMYASCDRISEARLVFDKMSYRDVVAWSIMIDGYHQSGLYDDVLQLFEEMRSSNLKPDEMVLTTIISACGRARNLSYGEAI 239          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A067GGS0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g004938mg PE=4 SV=1)

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 321/419 (76.61%), Postives = 376/419 (89.74%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDL+ WSAMISGYAE++ PQEAL+LF E+Q+ G++PD+VTMLSVISACA+LGVLD+A+ IH+Y DKN FGG LR+NNA+IDMYAKCGSLE AR VFE+M  RNVISWT MINAFAIHGDA NAL +F KMK+  ++PNGVTF+GVLYACSHAGLV++GR+IFASM NE+NI PK+EHYGCMVDL GRANLLREA+E+VETMPFAPNVVIWGSLM+AC++HGE EL EF AK++L+L+PDHDGALVLLSNIYAK+++WQ+VG+LR+ MKERGI KER  SRIE+NNEV+EFL ADR+HKQ  +IYEKLNEV+S LK  GY P+    LVDLE+EEKREV+LWHSEKLALCYGLI+  KDSCIRIVKNLRVCEDCH F+KLVSKVY REI++RDRTRFHHY+DGVCSC+DYW
Sbjct:  304 RLIFDQMVEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVISACAHLGVLDQAQRIHLYIDKNAFGGDLRVNNAIIDMYAKCGSLESAREVFERMRRRNVISWTSMINAFAIHGDARNALIFFNKMKDESIDPNGVTFIGVLYACSHAGLVDEGREIFASMTNEYNIPPKYEHYGCMVDLFGRANLLREALELVETMPFAPNVVIWGSLMAACRVHGEIELAEFAAKQLLQLDPDHDGALVLLSNIYAKDKRWQDVGELRKSMKERGILKERACSRIEMNNEVYEFLTADRSHKQTDQIYEKLNEVISELKPAGYVPDIHSALVDLEDEEKREVILWHSEKLALCYGLISSKKDSCIRIVKNLRVCEDCHNFIKLVSKVYAREIVIRDRTRFHHYKDGVCSCKDYW 722          

HSP 2 Score: 128.642 bits (322), Expect = 1.653e-28
Identity = 72/263 (27.38%), Postives = 132/263 (50.19%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSL-------------------------------ERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M  +D+V WS MI GY ++    E L LF+E+++  + PD++ +  ++SAC+  G L   + +H +   N       + + LI MYA CG +                               E AR +F++M  +++I W+ MI+ +A +     AL+ F +M+   ++P+ VT + V+ AC+H G+++  ++I    I+++           ++D+  +   L  A E+ E M    NV+ W S+++A  IHG+ 
Sbjct:  172 RLMFDKMSYRDIVPWSVMIDGYFQNGLFDEVLNLFEEMKMSNVEPDEMVLSKILSACSRAGNLSYGEAVHEFIIDNNVALDAHLQSTLITMYANCGCMDMAKGLFDKVLLKNLVVSTAMVSGYSRAGQVEDARLIFDQMVEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVISACAHLGVLDQAQRIHL-YIDKNAFGGDLRVNNAIIDMYAKCGSLESAREVFERMR-RRNVISWTSMINAFAIHGDA 432          

HSP 3 Score: 92.4337 bits (228), Expect = 1.264e-16
Identity = 69/287 (24.04%), Postives = 128/287 (44.60%), Query Frame = -2
Query:  592 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMIN---------EHNITPKHEHYGC---------------------MVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMS--ACQIHGETELGEFTAKRVLELEPDHDGALVLLS 1356
            IF Q+        +  I   + S +P+ AL++F ++   G+  D+ +   ++ A A    L +   +H    K GFG    +   L+ MY  CG +  AR +F+KM+ R+++ W+ MI+ +  +G  +  L  F++MK + VEP+ +    +L ACS AG +  G  +   +I+         +  +   + + GC                     MV    RA  + +A  I + M    +++ W +++S  A   H +  L  F   +V  ++PD    L ++S
Sbjct:   73 IFSQIPAPPSRVSNKFIRAISWSHRPKHALKVFLKMLNEGLTIDRFSFPPILKAIARAEGLLEGMQVHGLGTKLGFGSDPFVQTGLVGMYGACGKILDARLMFDKMSYRDIVPWSVMIDGYFQNGLFDEVLNLFEEMKMSNVEPDEMVLSKILSACSRAGNLSYGEAVHEFIIDNNVALDAHLQSTLITMYANCGCMDMAKGLFDKVLLKNLVVSTAMVSGYSRAGQVEDARLIFDQM-VEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVIS 358          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: V4S8H9_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10004433mg PE=4 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 319/419 (76.13%), Postives = 375/419 (89.50%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDL+ WSAMISGYAE++ PQEAL+LF E+Q+ G++PD+VTMLSVISACA+LGVLD+A+ IH+Y DKN FGG LR+NNA+IDMYAKCGSLE AR VFE+M  RNVISWT MINAFAIHGDA NAL +F KMK+  ++PNGVTF+GVLYACSHAGLV++GR+IFASM NE+NI PK+EHYGCMVDL GRANLLREA+E+VETMPFAPNVVIWGSLM+AC++HGE EL EF AK++L+L+PDH+GALVLLSNIYAK+++WQ+VG+LR+ MKERGI KER  SRIE+NNEV+EFL ADR+HKQ  +IYEKLNEV+S LK  GY P+    LVDLE+EEKREV+LWHSEKLALCYGLI+  KDSCI IVKNLRVCEDCH F+KLVSKVY REI++RDRTRFHHY+DGVCSC+DYW
Sbjct:  304 RLIFDQMVEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVISACAHLGVLDQAQRIHLYIDKNAFGGDLRVNNAIIDMYAKCGSLESAREVFERMRRRNVISWTSMINAFAIHGDARNALIFFNKMKDESIDPNGVTFIGVLYACSHAGLVDEGREIFASMTNEYNIPPKYEHYGCMVDLFGRANLLREALELVETMPFAPNVVIWGSLMAACRVHGEIELAEFAAKQLLQLDPDHNGALVLLSNIYAKDKRWQDVGELRKSMKERGILKERACSRIEMNNEVYEFLTADRSHKQTDQIYEKLNEVISELKPAGYVPDIHSALVDLEDEEKREVILWHSEKLALCYGLISSKKDSCIYIVKNLRVCEDCHNFIKLVSKVYAREIVIRDRTRFHHYKDGVCSCKDYW 722          

HSP 2 Score: 127.102 bits (318), Expect = 4.508e-28
Identity = 71/263 (27.00%), Postives = 132/263 (50.19%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSL-------------------------------ERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M  +D+V WS MI GY ++    + L LF+E+++  + PD++ +  ++SAC+  G L   + +H +   N       + + LI MYA CG +                               E AR +F++M  +++I W+ MI+ +A +     AL+ F +M+   ++P+ VT + V+ AC+H G+++  ++I    I+++           ++D+  +   L  A E+ E M    NV+ W S+++A  IHG+ 
Sbjct:  172 RLMFDKMSYRDIVPWSVMIDGYFQNGLFDDVLNLFEEMKMSNVEPDEMVLSKILSACSRAGNLSYGEAVHEFIIDNNVALDAHLQSTLITMYANCGCMDMAKGLFDKVLLKNLVVSTAMVSGYSRAGQVEDARLIFDQMVEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVISACAHLGVLDQAQRIHL-YIDKNAFGGDLRVNNAIIDMYAKCGSLESAREVFERMR-RRNVISWTSMINAFAIHGDA 432          

HSP 3 Score: 92.4337 bits (228), Expect = 9.727e-17
Identity = 69/287 (24.04%), Postives = 129/287 (44.95%), Query Frame = -2
Query:  592 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMIN---------EHNITPKHEHYGC---------------------MVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMS--ACQIHGETELGEFTAKRVLELEPDHDGALVLLS 1356
            IF Q+        +  I   + S +P+ AL++F ++   G+  D+ +   ++ A A    L +   +H    K GFG    +   L+ MY  CG +  AR +F+KM+ R+++ W+ MI+ +  +G  ++ L  F++MK + VEP+ +    +L ACS AG +  G  +   +I+         +  +   + + GC                     MV    RA  + +A  I + M    +++ W +++S  A   H +  L  F   +V  ++PD    L ++S
Sbjct:   73 IFSQIPAPPSRVSNKFIRAISWSHRPKHALKVFLKMLNEGLTIDRFSFPPILKAIARAEGLLEGMQVHGLGTKLGFGSDPFVQTGLVGMYGACGRILDARLMFDKMSYRDIVPWSVMIDGYFQNGLFDDVLNLFEEMKMSNVEPDEMVLSKILSACSRAGNLSYGEAVHEFIIDNNVALDAHLQSTLITMYANCGCMDMAKGLFDKVLLKNLVVSTAMVSGYSRAGQVEDARLIFDQM-VEKDLICWSAMISGYAENNHPQEALKLFNEMQVCGMKPDKVTMLSVIS 358          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: W9R134_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_005425 PE=4 SV=1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 326/419 (77.80%), Postives = 381/419 (90.93%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQMVEKDLVSWSAMI+GYAESD PQEALRLF ++Q+LGIRPDQ+TMLSVISACA+LG LDKA W+H+YAD+NGFGG+L ++NAL+DMYAKCGSLERAR VFEKM  +NVISWT MINA A+HGDA NAL  F +MK+  VEPN VTFVGVLYACSH GLVE+GR IFASMINE+NI PKHEHYGCMVDL GRANLLREA+E++ETMP APNV+IWGSLM+AC+IHGE ELGEF AKR+LELEPDHDGA V+LSNIYAKER+W++VG++R+LMK+ GI KERG+SRIE N+EVHEFL+ADRNHKQA +IYEKL+ +VS L+L GYAPNT  VLVDLEEEEK+EVVLWHSEKLAL YGLI+ +K+SCIR+VKNLR+CEDCHTF+KL SKVY +EI+VRDRTRFHH+++G+CSC+DYW
Sbjct:  310 RLIFDQMVEKDLVSWSAMIAGYAESDWPQEALRLFNDMQLLGIRPDQITMLSVISACAHLGALDKANWMHIYADRNGFGGALPVSNALVDMYAKCGSLERAREVFEKMQRKNVISWTSMINACAMHGDAVNALSLFHRMKDKNVEPNSVTFVGVLYACSHTGLVEEGRNIFASMINEYNIAPKHEHYGCMVDLFGRANLLREALEVIETMPVAPNVIIWGSLMAACRIHGENELGEFAAKRLLELEPDHDGAHVVLSNIYAKERRWEDVGNMRKLMKDSGILKERGFSRIESNSEVHEFLMADRNHKQADQIYEKLDNIVSDLRLAGYAPNTSSVLVDLEEEEKKEVVLWHSEKLALSYGLISESKESCIRVVKNLRICEDCHTFMKLSSKVYGKEIVVRDRTRFHHFKEGICSCKDYW 728          

HSP 2 Score: 137.887 bits (346), Expect = 1.539e-31
Identity = 78/265 (29.43%), Postives = 133/265 (50.19%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRN-------------------------------VISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGR--KIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M ++D+V+WS MI GY++S        L++E++  G+ PD++ + +++SAC   G L   K IH +  +N      R+ +AL+ MYA CGS++ A+ +F+KM+S+N                               ++SW+ MI  +A       ALR F  M+   + P+ +T + V+ AC+H G ++      I+A         P       +VD+  +   L  A E+ E M    NV+ W S+++AC +HG+ 
Sbjct:  178 RLVFDKMSQRDVVAWSIMIDGYSQSRLFDNVFNLYEEMRNSGVEPDEMILSTILSACGRAGNLSCGKAIHDFVVENSLLADSRLRSALVAMYASCGSMDIAQELFDKMSSKNLVVSTAMISGYSKLGRLQDARLIFDQMVEKDLVSWSAMIAGYAESDWPQEALRLFNDMQLLGIRPDQITMLSVISACAHLGALDKANWMHIYADRNGFGGALPVS---NALVDMYAKCGSLERAREVFEKMQ-RKNVISWTSMINACAMHGDA 438          

HSP 3 Score: 83.5741 bits (205), Expect = 8.428e-14
Identity = 53/214 (24.77%), Postives = 104/214 (48.60%), Query Frame = -2
Query:  634 EALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVL 1275
            + L ++  ++  G   D+ +  +V+ A      L++ + IH  A K GF     +   L+ MYA CG +   R VF+KM+ R+V++W+ MI+ ++     +N    +++M+ + VEP+ +    +L AC  AG +  G+ I    + E+++         +V +      +  A E+ + M  + N+V+     S   I G ++LG     R++
Sbjct:  106 KTLLVYGRMRREGSSVDRYSFPAVLKAAGKTQALEEGREIHGLATKMGFDSDPFVQTGLVRMYAGCGRILDGRLVFDKMSQRDVVAWSIMIDGYSQSRLFDNVFNLYEEMRNSGVEPDEMILSTILSACGRAGNLSCGKAIH-DFVVENSLLADSRLRSALVAMYASCGSMDIAQELFDKMS-SKNLVV-----STAMISGYSKLGRLQDARLI 312          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: D7T700_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g03630 PE=4 SV=1)

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 324/419 (77.33%), Postives = 375/419 (89.50%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R +F+QMV+KDLV WSAMISGYAESD PQEAL LF E+Q LGI+PDQVTMLSVI+ACA+LG LD+AKWIH++ DKNGFGG+L INNALI+MYAKCGSLERAR +F+KM  +NVISWT MI+AFA+HGDA +ALR+F +M++  +EPNG+TFVGVLYACSHAGLVE+GRKIF SMINEHNITPKH HYGCMVDL GRANLLREA+E+VE MP APNV+IWGSLM+AC++HGE ELGEF AKR+LEL+PDHDGA V LSNIYAK R+W++VG +R+LMK +GISKERG SR ELNNE+HEFLVADR+HK A EIYEKL EVVS+LKL GY+PNT  +LVDLEEEEK+EVVLWHSEKLALCYGL+     SCIRI+KNLRVCEDCHTF+KL SKVY REI+VRDRTRFHHY+DGVCSC+DYW
Sbjct:  309 RSVFNQMVKKDLVCWSAMISGYAESDSPQEALNLFNEMQSLGIKPDQVTMLSVITACAHLGALDQAKWIHLFVDKNGFGGALPINNALIEMYAKCGSLERARRIFDKMPRKNVISWTCMISAFAMHGDAGSALRFFHQMEDENIEPNGITFVGVLYACSHAGLVEEGRKIFYSMINEHNITPKHVHYGCMVDLFGRANLLREALELVEAMPLAPNVIIWGSLMAACRVHGEIELGEFAAKRLLELDPDHDGAHVFLSNIYAKARRWEDVGQVRKLMKHKGISKERGCSRFELNNEIHEFLVADRSHKHADEIYEKLYEVVSKLKLVGYSPNTCSILVDLEEEEKKEVVLWHSEKLALCYGLMRDGTGSCIRIIKNLRVCEDCHTFIKLASKVYEREIVVRDRTRFHHYKDGVCSCKDYW 727          

HSP 2 Score: 138.272 bits (347), Expect = 9.781e-32
Identity = 76/263 (28.90%), Postives = 133/263 (50.57%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVIS-------------------------------WTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD+M  +D+V+WS MI GY +S    +AL LF+E++   + PD++ + +V+SAC   G L   K IH +  +N       + +AL+ MYA CGS++ A N+FEKMT +N+++                               W+ MI+ +A       AL  F +M+   ++P+ VT + V+ AC+H G ++  + I    ++++           ++++  +   L  A  I + MP   NV+ W  ++SA  +HG+ 
Sbjct:  177 RLMFDKMFHRDVVTWSIMIDGYCQSGLFNDALLLFEEMKNYNVEPDEMMLSTVLSACGRAGNLSYGKMIHDFIMENNIVVDPHLQSALVTMYASCGSMDLALNLFEKMTPKNLVASTAMVTGYSKLGQIENARSVFNQMVKKDLVCWSAMISGYAESDSPQEALNLFNEMQSLGIKPDQVTMLSVITACAHLGALDQAKWIHL-FVDKNGFGGALPINNALIEMYAKCGSLERARRIFDKMP-RKNVISWTCMISAFAMHGDA 437          

HSP 3 Score: 97.8265 bits (242), Expect = 1.848e-18
Identity = 73/267 (27.34%), Postives = 129/267 (48.31%), Query Frame = -2
Query:  508 AESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEF-TAKRVLELEPDHDGALVLLSNI---YAKERKWQNVGDLRQLMKERGISKER 1296
            + S++P++ L +++ ++  G+  D+ +   ++ A + +  L +   IH  A K GF     +   L+ MYA CG +  AR +F+KM  R+V++W+ MI+ +   G  N+AL  F++MK   VEP+ +    VL AC  AG +  G K+    I E+NI         +V +      +  A+ + E M   P  ++  + M    + G ++LG+   A+ V       D  LV  S +   YA+    Q   +L   M+  GI  ++
Sbjct:   98 SRSEEPEKTLLVYERMRTQGLAVDRFSFPPLLKALSRVKSLVEGLEIHGLAAKLGFDSDPFVQTGLVRMYAACGRIAEARLMFDKMFHRDVVTWSIMIDGYCQSGLFNDALLLFEEMKNYNVEPDEMMLSTVLSACGRAGNLSYG-KMIHDFIMENNIVVDPHLQSALVTMYASCGSMDLALNLFEKM--TPKNLVASTAM----VTGYSKLGQIENARSVFNQMVKKD--LVCWSAMISGYAESDSPQEALNLFNEMQSLGIKPDQ 355          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A067L6S3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_02188 PE=4 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 319/419 (76.13%), Postives = 362/419 (86.40%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFD+M +KDLV WSAMISGYAESDQPQEAL LF E+Q LGI PD+VTMLSVISACA+LGVLD+AK IH++ +++GFGG L +NNALIDMYAKCG LE AR VFEKM  RNVISWT MINAFAIHGDAN+AL +F +MK+  +EPN VTFVGVLYACSHAGLVE+G+KIFASMIN++NI+PKHEHYGCMVDL GRA  LREA+ +VETM   PNVVIWGSLM+AC++HGETELGEF A+R+LELEP HDGALVLLSNIYAKE++WQ+VG +R LMK+RGI KERG SRIEL+N VHEF  ADR HKQA  IYEKL+EVV  LK  GY+P+T  VLVD+EEE K EVVLWHSEKLALCYGLI+  K SCIRIVKNLR+CEDCH F+KLVSK Y  EIIVRDRTRFH Y+DGVCSC DYW
Sbjct:  305 RLIFDEMDKKDLVCWSAMISGYAESDQPQEALNLFNEMQALGIEPDEVTMLSVISACAHLGVLDQAKRIHMFVNESGFGGVLPVNNALIDMYAKCGCLEAARAVFEKMQRRNVISWTSMINAFAIHGDANSALNFFHRMKDENIEPNAVTFVGVLYACSHAGLVEEGQKIFASMINDYNISPKHEHYGCMVDLFGRAKFLREALNLVETMSLPPNVVIWGSLMAACRVHGETELGEFAAQRLLELEPGHDGALVLLSNIYAKEKRWQDVGQIRNLMKQRGIFKERGCSRIELSNGVHEFSTADRKHKQADLIYEKLDEVVGNLKFVGYSPDTSVVLVDIEEEAKNEVVLWHSEKLALCYGLISQGKGSCIRIVKNLRICEDCHNFMKLVSKAYELEIIVRDRTRFHRYKDGVCSCNDYW 723          

HSP 2 Score: 140.584 bits (353), Expect = 1.736e-32
Identity = 84/294 (28.57%), Postives = 148/294 (50.34%), Query Frame = -2
Query:  580 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRN-------------------------------VISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGE--TELGEFTAKRVLELEPDHDGALVLLSNIYA 1362
            RL+FD+M  +D+V+WS MI+GY ++    EAL+ F+E++   ++PD+V + ++ISAC+  G L   K +H +  +N       + + LI MYA CG ++ A+ +F KM+SRN                               ++ W+ MI+ +A       AL  F +M+   +EP+ VT + V+ AC+H G+++  ++I    +NE            ++D+  +   L  A  + E M    NV+ W S+++A  IHG+  + L  F   +   +EP+   A+  +  +YA
Sbjct:  173 RLVFDKMSYRDVVTWSIMINGYYQNGHFDEALKFFEEMKSSNVQPDKVVLSTIISACSRAGNLSYGKAVHDFIIENNIEVDPHLESTLIFMYANCGCMDMAKELFFKMSSRNLVVSTAMVSGYSRVGNVKDARLIFDEMDKKDLVCWSAMISGYAESDQPQEALNLFNEMQALGIEPDEVTMLSVISACAHLGVLDQAKRIHM-FVNESGFGGVLPVNNALIDMYAKCGCLEAARAVFEKMQ-RRNVISWTSMINAFAIHGDANSALNFFHRMKDENIEPN---AVTFVGVLYA 461          

HSP 3 Score: 97.4413 bits (241), Expect = 2.397e-18
Identity = 86/345 (24.93%), Postives = 165/345 (47.83%), Query Frame = -2
Query:  307 AESDQPQEALRLFKELQ---ILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNI--YAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNE-------VVSRLKLDGYAPNTGCVLVD---LEEEEKREVVLWHS 1296
            + S +P+  L ++++++   + G+  D+ ++  ++ A A +  L++   IH  A K GF     +   L+ +Y  CG +  AR VF+KM+ R+V++W+ MIN +  +G  + AL++F++MK + V+P+ V    ++ ACS AG +  G+ +   +I E+NI         ++ +      +  A E+   M  + N+V+     S   + G + +G     R++  E D    +   + I  YA+  + Q   +L   M+  GI  +   + + + +      V D    QA  I+  +NE        V+   +D YA   GC+       E+ ++R V+ W S
Sbjct:   93 SRSSKPETVLLVYEKIREDGLFGV--DRFSLPLLLKAAAKVSALNEGMEIHGVATKLGFDKDPFVQTGLMSLYLACGKILEARLVFDKMSYRDVVTWSIMINGYYQNGHFDEALKFFEEMKSSNVQPDKVVLSTIISACSRAGNLSYGKAVHDFII-ENNIEVDPHLESTLIFMYANCGCMDMAKELFFKMS-SRNLVV-----STAMVSGYSRVGNVKDARLIFDEMDKKDLVCWSAMISGYAESDQPQEALNLFNEMQALGIEPDE-VTMLSVISACAHLGVLD----QAKRIHMFVNESGFGGVLPVNNALIDMYA-KCGCLEAARAVFEKMQRRNVISWTS 422          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Match: A0A059D1A8_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B01082 PE=4 SV=1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 306/419 (73.03%), Postives = 371/419 (88.54%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            RLIFDQ+ EKDLV WSAMISGYAESDQPQEAL LFK++Q+ GI+PDQVT+LS +SACA+LG LD+ +W+H Y D+NGFG +L + N LIDMYAKCGSLERA+ VFEK +S+NVISWT MIN+FA+HGDANN LR+F +MKE  VEPN +TF+GVLYACSHAGLVE G++IF+SM++EHN+ PKHEHYGCMVDL GRA LLREA+E++ETMP APNVVIWGSLM+AC++HGE ELGEF AK++L+LEPDHDGA V+LSNIYAK R+WQ+VG+LRQLM++RG+ K RG+SRIELNNEVH+F +ADR+H QA +I+ KL+EVV  LKL GYAP+  CVLVD+E+E+K EVVLWHSEKLA+CYGL+     SCIRI+KNLR+CEDCHTF+KL+SK YRREIIVRDRTRFHH++DG+CSCRDYW
Sbjct:  309 RLIFDQLDEKDLVCWSAMISGYAESDQPQEALTLFKKMQMWGIKPDQVTILSALSACAHLGALDQGRWMHKYVDENGFGEALPVKNVLIDMYAKCGSLERAQKVFEKTSSKNVISWTTMINSFAMHGDANNVLRFFYQMKEENVEPNEITFIGVLYACSHAGLVEKGQEIFSSMVSEHNLKPKHEHYGCMVDLFGRAGLLREALEVIETMPLAPNVVIWGSLMAACRVHGEDELGEFAAKQLLKLEPDHDGAHVVLSNIYAKHRRWQDVGELRQLMRQRGVFKARGWSRIELNNEVHQFAMADRDHNQADQIFVKLDEVVRELKLVGYAPSAHCVLVDVEDEDKSEVVLWHSEKLAVCYGLLTERTGSCIRIIKNLRICEDCHTFMKLISKEYRREIIVRDRTRFHHFKDGICSCRDYW 727          

HSP 2 Score: 126.331 bits (316), Expect = 9.737e-28
Identity = 72/263 (27.38%), Postives = 131/263 (49.81%), Query Frame = -2
Query:  667 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRN-------------------------------VISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1362
            RL+FD M ++D+VSWS MI G+ ++    EA+ LF+E++   + PD++ + S++SAC   G L   K IH Y  +N       I +ALI MYA  G ++ A+ +F+ M+ +N                               ++ W+ MI+ +A       AL  F+KM+   ++P+ VT +  L AC+H G ++ GR +    ++E+           ++D+  +   L  A ++ E    + NV+ W +++++  +HG+ 
Sbjct:  177 RLLFDTMSQRDVVSWSIMIDGFCQNGLFDEAMSLFEEMRRSNVEPDRMILSSILSACGRAGNLSYGKKIHDYITENNVILDPHIWSALISMYASSGCMDLAQELFDSMSPKNLVVSTAMISWYSKVRKMENARLIFDQLDEKDLVCWSAMISGYAESDQPQEALTLFKKMQMWGIKPDQVTILSALSACAHLGALDQGRWMH-KYVDENGFGEALPVKNVLIDMYAKCGSLERAQKVFEKTS-SKNVISWTTMINSFAMHGDA 437          

HSP 3 Score: 97.0561 bits (240), Expect = 3.402e-18
Identity = 57/202 (28.22%), Postives = 108/202 (53.47%), Query Frame = -2
Query:  691 AESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMS 1296
            +  D+P +AL +F E+   G+  D+ +   ++ A +    L +   IH    K G+GG   +  AL+ MYA  G +  AR +F+ M+ R+V+SW+ MI+ F  +G  + A+  F++M+ + VEP+ +    +L AC  AG +  G+KI    I E+N+      +  ++ +   +  +  A E+ ++M    N+V+  +++S
Sbjct:   98 SRGDRPGDALIVFDEMWREGVVLDRFSFPPLLKAGSKEVGLVEGSEIHGLVVKLGYGGDPFVQTALVRMYAAGGRIVDARLLFDTMSQRDVVSWSIMIDGFCQNGLFDEAMSLFEEMRRSNVEPDRMILSSILSACGRAGNLSYGKKIH-DYITENNVILDPHIWSALISMYASSGCMDLAQELFDSMS-PKNLVVSTAMIS 297          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP311_ARATH (Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 289/425 (68.00%), Postives = 355/425 (83.53%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLIN----GAKDSC--IRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            ++IFDQ  +KDLV W+ MIS Y ESD PQEALR+F+E+   GI+PD V+M SVISACANLG+LDKAKW+H     NG    L INNALI+MYAKCG L+  R+VFEKM  RNV+SW+ MINA ++HG+A++AL  F +MK+  VEPN VTFVGVLY CSH+GLVE+G+KIFASM +E+NITPK EHYGCMVDL GRANLLREA+E++E+MP A NVVIWGSLMSAC+IHGE ELG+F AKR+LELEPDHDGALVL+SNIYA+E++W++V ++R++M+E+ + KE+G SRI+ N + HEFL+ D+ HKQ+ EIY KL+EVVS+LKL GY P+ G VLVD+EEEEK+++VLWHSEKLALC+GL+N      KDSC  IRIVKNLRVCEDCH F KLVSKVY REIIVRDRTRFH Y++G+CSCRDYW
Sbjct:  298 QVIFDQTEKKDLVCWTTMISAYVESDYPQEALRVFEEMCCSGIKPDVVSMFSVISACANLGILDKAKWVHSCIHVNGLESELSINNALINMYAKCGGLDATRDVFEKMPRRNVVSWSSMINALSMHGEASDALSLFARMKQENVEPNEVTFVGVLYGCSHSGLVEEGKKIFASMTDEYNITPKLEHYGCMVDLFGRANLLREALEVIESMPVASNVVIWGSLMSACRIHGELELGKFAAKRILELEPDHDGALVLMSNIYAREQRWEDVRNIRRVMEEKNVFKEKGLSRIDQNGKSHEFLIGDKRHKQSNEIYAKLDEVVSKLKLAGYVPDCGSVLVDVEEEEKKDLVLWHSEKLALCFGLMNEEKEEEKDSCGVIRIVKNLRVCEDCHLFFKLVSKVYEREIIVRDRTRFHCYKNGLCSCRDYW 722          

HSP 2 Score: 114.005 bits (284), Expect = 1.063e-25
Identity = 73/281 (25.98%), Postives = 134/281 (47.69%), Query Frame = -2
Query:  619 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRN-------------------------------VISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE--LGEFTAKRVLELEPD 1362
            R +FD+M  +D+V+W+ MI  Y       EA +LF+E++   + PD++ + +++SAC   G +   + I+ +  +N       +  AL+ MYA  G ++ AR  F KM+ RN                               ++ WT MI+A+        ALR F++M  + ++P+ V+   V+ AC++ G++ D  K   S I+ + +  +      ++++  +   L    ++ E MP   NVV W S+++A  +HGE    L  F   +   +EP+
Sbjct:  166 RNVFDEMSHRDVVTWNTMIERYCRFGLVDEAFKLFEEMKDSNVMPDEMILCNIVSACGRTGNMRYNRAIYEFLIENDVRMDTHLLTALVTMYAGAGCMDMAREFFRKMSVRNLFVSTAMVSGYSKCGRLDDAQVIFDQTEKKDLVCWTTMISAYVESDYPQEALRVFEEMCCSGIKPDVVSMFSVISACANLGIL-DKAKWVHSCIHVNGLESELSINNALINMYAKCGGLDATRDVFEKMP-RRNVVSWSSMINALSMHGEASDALSLFARMKQENVEPN 444          

HSP 3 Score: 90.1225 bits (222), Expect = 7.302e-18
Identity = 52/231 (22.51%), Postives = 108/231 (46.75%), Query Frame = -2
Query:  634 VSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVL 1326
            + ++  +   + S +P+  +  ++ ++ +G R DQ + L ++ A + +  L +   +H  A K        +    +DMYA CG +  ARNVF++M+ R+V++W  MI  +   G  + A + F++MK++ V P+ +    ++ AC   G +   R I+  +I E+++         +V +   A  +  A E    M       +    +S   + G ++ G     +V+
Sbjct:   77 IVFNPFLRDLSRSSEPRATILFYQRIRHVGGRLDQFSFLPILKAVSKVSALFEGMELHGVAFKIATLCDPFVETGFMDMYASCGRINYARNVFDEMSHRDVVTWNTMIERYCRFGLVDEAFKLFEEMKDSNVMPDEMILCNIVSACGRTGNMRYNRAIYEFLI-ENDVRMDTHLLTALVTMYAGAGCMDMAREFFRKMS------VRNLFVSTAMVSGYSKCGRLDDAQVI 300          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP330_ARATH (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2)

HSP 1 Score: 450.669 bits (1158), Expect = 2.381e-151
Identity = 202/418 (48.33%), Postives = 299/418 (71.53%), Query Frame = -2
Query:  106 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEAR-VEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1356
            +FD+M EKDLV+W+++I+G+AE+ +P+EAL L+ E+   GI+PD  T++S++SACA +G L   K +HVY  K G   +L  +N L+D+YA+CG +E A+ +F++M  +N +SWT +I   A++G    A+  F+ M+    + P  +TFVG+LYACSH G+V++G + F  M  E+ I P+ EH+GCMVDLL RA  +++A E +++MP  PNVVIW +L+ AC +HG+++L EF   ++L+LEP+H G  VLLSN+YA E++W +V  +R+ M   G+ K  G+S +E+ N VHEFL+ D++H Q+  IY KL E+  RL+ +GY P    V VD+EEEEK   V++HSEK+A+ + LI+  + S I +VKNLRVC DCH  +KLVSKVY REI+VRDR+RFHH+++G CSC+DYW
Sbjct:  178 VFDKMPEKDLVAWNSVINGFAENGKPEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYARCGRVEEAKTLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFVGILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIKSMPMQPNVVIWRTLLGACTVHGDSDLAEFARIQILQLEPNHSGDYVLLSNMYASEQRWSDVQKIRKQMLRDGVKKVPGHSLVEVGNRVHEFLMGDKSHPQSDAIYAKLKEMTGRLRSEGYVPQISNVYVDVEEEEKENAVVYHSEKIAIAFMLISTPERSPITVVKNLRVCADCHLAIKLVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW 595          

HSP 2 Score: 118.627 bits (296), Expect = 2.420e-27
Identity = 64/217 (29.49%), Postives = 112/217 (51.61%), Query Frame = -2
Query:  673 WSAMISGYAESDQPQEALRLFKELQILG-IRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHG 1320
            W+ +I GYAE      A  L++E+++ G + PD  T   +I A   +  +   + IH    ++GFG  + + N+L+ +YA CG +  A  VF+KM  +++++W  +IN FA +G    AL  + +M    ++P+G T V +L AC+  G +  G+++   MI    +T        ++DL  R   + EA  + + M    N V W SL+    ++G
Sbjct:   88 WNTLIRGYAEIGNSISAFSLYREMRVSGLVEPDTHTYPFLIKAVTTMADVRLGETIHSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGKPEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKV-GLTRNLHSSNVLLDLYARCGRVEEAKTLFDEM-VDKNSVSWTSLIVGLAVNG 302          

HSP 3 Score: 72.4034 bits (176), Expect = 3.077e-12
Identity = 39/150 (26.00%), Postives = 88/150 (58.67%), Query Frame = -2
Query:  922 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQIL-GIRPDQVTMLSVISACANLGVLDKA-KWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSR-NVISWTGMINAFAIHGDANNALRYFQKMKEARVEPN 1362
            + +FD+MV+K+ VSW+++I G A +   +EA+ LFK ++   G+ P ++T + ++ AC++ G++ +  ++     ++      +     ++D+ A+ G +++A    + M  + NV+ W  ++ A  +HGD++  L  F +++  ++EPN
Sbjct:  277 KTLFDEMVDKNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFVGILYACSHCGMVKEGFEYFRRMREEYKIEPRIEHFGCMVDLLARAGQVKKAYEYIKSMPMQPNVVIWRTLLGACTVHGDSD--LAEFARIQILQLEPN 424          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP175_ARATH (Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 1.787e-146
Identity = 205/421 (48.69%), Postives = 289/421 (68.65%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQIL-GIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVL-WHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R + + M +KD+V+W+A+IS Y ++ +P EAL +F ELQ+   ++ +Q+T++S +SACA +G L+  +WIH Y  K+G   +  + +ALI MY+KCG LE++R VF  +  R+V  W+ MI   A+HG  N A+  F KM+EA V+PNGVTF  V  ACSH GLV++   +F  M + + I P+ +HY C+VD+LGR+  L +AV+ +E MP  P+  +WG+L+ AC+IH    L E    R+LELEP +DGA VLLSNIYAK  KW+NV +LR+ M+  G+ KE G S IE++  +HEFL  D  H  + ++Y KL+EV+ +LK +GY P    VL  +EEEE +E  L  HSEKLA+CYGLI+      IR++KNLRVC DCH+  KL+S++Y REIIVRDR RFHH+R+G CSC D+W
Sbjct:  318 REVLNSMPQKDIVAWNALISAYEQNGKPNEALIVFHELQLQKNMKLNQITLVSTLSACAQVGALELGRWIHSYIKKHGIRMNFHVTSALIHMYSKCGDLEKSREVFNSVEKRDVFVWSAMIGGLAMHGCGNEAVDMFYKMQEANVKPNGVTFTNVFCACSHTGLVDEAESLFHQMESNYGIVPEEKHYACIVDVLGRSGYLEKAVKFIEAMPIPPSTSVWGALLGACKIHANLNLAEMACTRLLELEPRNDGAHVLLSNIYAKLGKWENVSELRKHMRVTGLKKEPGCSSIEIDGMIHEFLSGDNAHPMSEKVYGKLHEVMEKLKSNGYEPEISQVLQIIEEEEMKEQSLNLHSEKLAICYGLISTEAPKVIRVIKNLRVCGDCHSVAKLISQLYDREIIVRDRYRFHHFRNGQCSCNDFW 738          

HSP 2 Score: 127.102 bits (318), Expect = 6.114e-30
Identity = 72/260 (27.69%), Postives = 135/260 (51.92%), Query Frame = -2
Query:  673 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAI-------------------------------HGDANNALRYFQKMK-EARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHG 1356
            +F  + EKD+VSW++MI+G+ +   P +AL LFK+++   ++   VTM+ V+SACA +  L+  + +  Y ++N    +L + NA++DMY KCGS+E A+ +F+ M  ++ ++WT M++ +AI                               +G  N AL  F +++ +  ++ N +T V  L AC+  G +E GR I  S I +H I         ++ +  +   L ++ E+  ++    +V +W +++    +HG
Sbjct:  188 VFTTIKEKDVVSWNSMINGFVQKGSPDKALELFKKMESEDVKASHVTMVGVLSACAKIRNLEFGRQVCSYIEENRVNVNLTLANAMLDMYTKCGSIEDAKRLFDAMEEKDNVTWTTMLDGYAISEDYEAAREVLNSMPQKDIVAWNALISAYEQNGKPNEALIVFHELQLQKNMKLNQITLVSTLSACAQVGALELGRWIH-SYIKKHGIRMNFHVTSALIHMYSKCGDLEKSREVFNSVE-KRDVFVWSAMIGGLAMHG 445          

HSP 3 Score: 110.153 bits (274), Expect = 2.214e-24
Identity = 71/251 (28.29%), Postives = 121/251 (48.21%), Query Frame = -2
Query:  613 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKEL-QILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHD 1362
            R +FD++ + +  +W+ +I  YA    P  ++  F ++       P++ T   +I A A +  L   + +H  A K+  G  + + N+LI  Y  CG L+ A  VF  +  ++V+SW  MIN F   G  + AL  F+KM+   V+ + VT VGVL AC+    +E GR++  S I E+ +         M+D+  +   + +A  + + M    NV  W +++    I  + E     A+ VL   P  D
Sbjct:   84 RKVFDEIPKPNSFAWNTLIRAYASGPDPVLSIWAFLDMVSESQCYPNKYTFPFLIKAAAEVSSLSLGQSLHGMAVKSAVGSDVFVANSLIHCYFSCGDLDSACKVFTTIKEKDVVSWNSMINGFVQKGSPDKALELFKKMESEDVKASHVTMVGVLSACAKIRNLEFGRQV-CSYIEENRVNVNLTLANAMLDMYTKCGSIEDAKRLFDAMEEKDNVT-WTTMLDGYAISEDYE----AAREVLNSMPQKD 328          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP425_ARATH (Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 2.999e-143
Identity = 200/419 (47.73%), Postives = 298/419 (71.12%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R++FD+M ++ +VSW+ MISGY+ +   ++A+ +F+E++   IRP+ VT++SV+ A + LG L+  +W+H+YA+ +G      + +ALIDMY+KCG +E+A +VFE++   NVI+W+ MIN FAIHG A +A+  F KM++A V P+ V ++ +L ACSH GLVE+GR+ F+ M++   + P+ EHYGCMVDLLGR+ LL EA E +  MP  P+ VIW +L+ AC++ G  E+G+  A  ++++ P   GA V LSN+YA +  W  V ++R  MKE+ I K+ G S I+++  +HEF+V D +H +A EI   L E+  +L+L GY P T  VL++LEEE+K  V+ +HSEK+A  +GLI+ +    IRIVKNLR+CEDCH+ +KL+SKVY+R+I VRDR RFHH++DG CSC DYW
Sbjct:  228 RMLFDKMRQRSVVSWNTMISGYSLNGFFKDAVEVFREMKKGDIRPNYVTLVSVLPAISRLGSLELGEWLHLYAEDSGIRIDDVLGSALIDMYSKCGIIEKAIHVFERLPRENVITWSAMINGFAIHGQAGDAIDCFCKMRQAGVRPSDVAYINLLTACSHGGLVEEGRRYFSQMVSVDGLEPRIEHYGCMVDLLGRSGLLDEAEEFILNMPIKPDDVIWKALLGACRMQGNVEMGKRVANILMDMVPHDSGAYVALSNMYASQGNWSEVSEMRLRMKEKDIRKDPGCSLIDIDGVLHEFVVEDDSHPKAKEINSMLVEISDKLRLAGYRPITTQVLLNLEEEDKENVLHYHSEKIATAFGLISTSPGKPIRIVKNLRICEDCHSSIKLISKVYKRKITVRDRKRFHHFQDGSCSCMDYW 646          

HSP 2 Score: 118.242 bits (295), Expect = 3.865e-27
Identity = 77/280 (27.50%), Postives = 135/280 (48.21%), Query Frame = -2
Query:  667 IFDQMVEKDLVSWSAMISGYAESDQPQE--ALRLFKELQI-LGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLE---------------------------------------------RARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGR--KIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGET 1356
            IF+QM +++  SW+ +I G++ESD+ +   A+ LF E+     + P++ T  SV+ ACA  G + + K IH  A K GFGG   + + L+ MY  CG ++                                              AR +F+KM  R+V+SW  MI+ ++++G   +A+  F++MK+  + PN VT V VL A S  G +E G    ++A    +  I         ++D+  +  ++ +A+ + E +P   NV+ W ++++   IHG+ 
Sbjct:   81 IFNQMPQRNCFSWNTIIRGFSESDEDKALIAITLFYEMMSDEFVEPNRFTFPSVLKACAKTGKIQEGKQIHGLALKYGFGGDEFVMSNLVRMYVMCGFMKDARVLFYKNIIEKDMVVMTDRRKRDGEIVLWNVMIDGYMRLGDCKAARMLFDKMRQRSVVSWNTMISGYSLNGFFKDAVEVFREMKKGDIRPNYVTLVSVLPAISRLGSLELGEWLHLYA---EDSGIRIDDVLGSALIDMYSKCGIIEKAIHVFERLP-RENVITWSAMINGFAIHGQA 356          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP449_ARATH (Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.319e-139
Identity = 196/418 (46.89%), Postives = 282/418 (67.46%), Query Frame = -2
Query:  106 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKRE-VVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1356
            +F +M EK+ +SW+ MISGY ++D  +EAL+LF E+Q   + PD V++ + +SACA LG L++ KWIH Y +K        +   LIDMYAKCG +E A  VF+ +  ++V +WT +I+ +A HG    A+  F +M++  ++PN +TF  VL ACS+ GLVE+G+ IF SM  ++N+ P  EHYGC+VDLLGRA LL EA   ++ MP  PN VIWG+L+ AC+IH   ELGE   + ++ ++P H G  V  +NI+A ++KW    + R+LMKE+G++K  G S I L    HEFL  DR+H +  +I  K   +  +L+ +GY P    +L+DL ++++RE +V  HSEKLA+ YGLI     + IRI+KNLRVC+DCH   KL+SK+Y+R+I++RDRTRFHH+RDG CSC DYW
Sbjct:  203 LFRKMAEKNAISWTTMISGYVQADMNKEALQLFHEMQNSDVEPDNVSLANALSACAQLGALEQGKWIHSYLNKTRIRMDSVLGCVLIDMYAKCGEMEEALEVFKNIKKKSVQAWTALISGYAYHGHGREAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYNLKPTIEHYGCIVDLLGRAGLLDEAKRFIQEMPLKPNAVIWGALLKACRIHKNIELGEEIGEILIAIDPYHGGRYVHKANIHAMDKKWDKAAETRRLMKEQGVAKVPGCSTISLEGTTHEFLAGDRSHPEIEKIQSKWRIMRRKLEENGYVPELEEMLLDLVDDDEREAIVHQHSEKLAITYGLIKTKPGTIIRIMKNLRVCKDCHKVTKLISKIYKRDIVMRDRTRFHHFRDGKCSCGDYW 620          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP145_ARATH (Pentatricopeptide repeat-containing protein At2g02980, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2)

HSP 1 Score: 419.468 bits (1077), Expect = 3.952e-139
Identity = 191/420 (45.48%), Postives = 289/420 (68.81%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVL-VDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R +FD++VE  +V ++AMI+GYA  ++P EAL LF+E+Q   ++P+++T+LSV+S+CA LG LD  KWIH YA K+ F   +++N ALIDM+AKCGSL+ A ++FEKM  ++  +W+ MI A+A HG A  ++  F++M+   V+P+ +TF+G+L ACSH G VE+GRK F+ M+++  I P  +HYG MVDLL RA  L +A E ++ +P +P  ++W  L++AC  H   +L E  ++R+ EL+  H G  V+LSN+YA+ +KW+ V  LR++MK+R   K  G S IE+NN VHEF   D       +++  L+E+V  LKL GY P+T  V+  ++ ++EK   + +HSEKLA+ +GL+N    + IR+VKNLRVC DCH   KL+S ++ R++++RD  RFHH+ DG CSC D+W
Sbjct:  184 RCVFDRIVEPCVVCYNAMITGYARRNRPNEALSLFREMQGKYLKPNEITLLSVLSSCALLGSLDLGKWIHKYAKKHSFCKYVKVNTALIDMFAKCGSLDDAVSIFEKMRYKDTQAWSAMIVAYANHGKAEKSMLMFERMRSENVQPDEITFLGLLNACSHTGRVEEGRKYFSQMVSKFGIVPSIKHYGSMVDLLSRAGNLEDAYEFIDKLPISPTPMLWRILLAACSSHNNLDLAEKVSERIFELDDSHGGDYVILSNLYARNKKWEYVDSLRKVMKDRKAVKVPGCSSIEVNNVVHEFFSGDGVKSATTKLHRALDEMVKELKLSGYVPDTSMVVHANMNDQEKEITLRYHSEKLAITFGLLNTPPGTTIRVVKNLRVCRDCHNAAKLISLIFGRKVVLRDVQRFHHFEDGKCSCGDFW 603          

HSP 2 Score: 124.02 bits (310), Expect = 3.777e-29
Identity = 86/318 (27.04%), Postives = 153/318 (48.11%), Query Frame = -2
Query:  415 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE--LGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKL 1362
            R +F+ M E D+V +++M  GY+    P E   LF E+   GI PD  T  S++ ACA    L++ + +H  + K G   ++ +   LI+MY +C  ++ AR VF+++    V+ +  MI  +A     N AL  F++M+   ++PN +T + VL +C+  G ++ G+ I      +H+     +    ++D+  +   L +AV I E M +  +   W +++ A   HG+ E  +  F   R   ++PD    L LL+      R  +      Q++ + GI        I+    + + L    N + AYE  +KL
Sbjct:   83 RHLFEAMSEPDIVIFNSMARGYSRFTNPLEVFSLFVEILEDGILPDNYTFPSLLKACAVAKALEEGRQLHCLSMKLGLDDNVYVCPTLINMYTECEDVDSARCVFDRIVEPCVVCYNAMITGYARRNRPNEALSLFREMQGKYLKPNEITLLSVLSSCALLGSLDLGKWIH-KYAKKHSFCKYVKVNTALIDMFAKCGSLDDAVSIFEKMRYK-DTQAWSAMIVAYANHGKAEKSMLMFERMRSENVQPDEITFLGLLNACSHTGRVEEGRKYFSQMVSKFGI-----VPSIKHYGSMVDLLSRAGNLEDAYEFIDKL 393          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP354_ARATH (Pentatricopeptide repeat-containing protein ELI1, chloroplastic OS=Arabidopsis thaliana GN=ELI1 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 3.145e-138
Identity = 195/421 (46.32%), Postives = 282/421 (66.98%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILG-IRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKE-ARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R +FD M E+D+VSW+ MI GYA+   P +AL LF++L   G  +PD++T+++ +SAC+ +G L+  +WIHV+   +    ++++   LIDMY+KCGSLE A  VF     +++++W  MI  +A+HG + +ALR F +M+    ++P  +TF+G L AC+HAGLV +G +IF SM  E+ I PK EHYGC+V LLGRA  L+ A E ++ M    + V+W S++ +C++HG+  LG+  A+ ++ L   + G  VLLSNIYA    ++ V  +R LMKE+GI KE G S IE+ N+VHEF   DR H ++ EIY  L ++  R+K  GY PNT  VL DLEE EK + +  HSE+LA+ YGLI+    S ++I KNLRVC DCHT  KL+SK+  R+I++RDR RFHH+ DG CSC D+W
Sbjct:  212 RALFDSMCERDIVSWNVMIDGYAQHGFPNDALMLFQKLLAEGKPKPDEITVVAALSACSQIGALETGRWIHVFVKSSRIRLNVKVCTGLIDMYSKCGSLEEAVLVFNDTPRKDIVAWNAMIAGYAMHGYSQDALRLFNEMQGITGLQPTDITFIGTLQACAHAGLVNEGIRIFESMGQEYGIKPKIEHYGCLVSLLGRAGQLKRAYETIKNMNMDADSVLWSSVLGSCKLHGDFVLGKEIAEYLIGLNIKNSGIYVLLSNIYASVGDYEGVAKVRNLMKEKGIVKEPGISTIEIENKVHEFRAGDREHSKSKEIYTMLRKISERIKSHGYVPNTNTVLQDLEETEKEQSLQVHSERLAIAYGLISTKPGSPLKIFKNLRVCSDCHTVTKLISKITGRKIVMRDRNRFHHFTDGSCSCGDFW 632          

HSP 2 Score: 103.99 bits (258), Expect = 1.925e-22
Identity = 71/263 (27.00%), Postives = 123/263 (46.77%), Query Frame = -2
Query:  664 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFG-------------------------------GSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQK-MKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE 1356
            +F Q ++ DL  ++A I+  + +    +A  L+ +L    I P++ T  S++ +C+        K IH +  K G G                                SL  + A+I  YAK G++E AR +F+ M  R+++SW  MI+ +A HG  N+AL  FQK + E + +P+ +T V  L ACS  G +E GR I    +    I    +    ++D+  +   L EAV +    P   ++V W ++++   +HG ++
Sbjct:   86 LFHQTIDPDLFLFTAAINTASINGLKDQAFLLYVQLLSSEINPNEFTFSSLLKSCST----KSGKLIHTHVLKFGLGIDPYVATGLVDVYAKGGDVVSAQKVFDRMPERSLVSSTAMITCYAKQGNVEAARALFDSMCERDIVSWNVMIDGYAQHGFPNDALMLFQKLLAEGKPKPDEITVVAALSACSQIGALETGRWIHV-FVKSSRIRLNVKVCTGLIDMYSKCGSLEEAVLVFNDTP-RKDIVAWNAMIAGYAMHGYSQ 342          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP410_ARATH (Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.041e-135
Identity = 191/419 (45.58%), Postives = 277/419 (66.11%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R +F+ M E+D ++W+AMISGYA+  + +EAL +F  +Q+ G++ + V M+SV+SAC  LG LD+ +W H Y ++N    ++R+   L+D+YAKCG +E+A  VF  M  +NV +W+  +N  A++G     L  F  MK+  V PN VTFV VL  CS  G V++G++ F SM NE  I P+ EHYGC+VDL  RA  L +AV I++ MP  P+  +W SL+ A +++   ELG   +K++LELE  + GA VLLSNIYA    W NV  +RQ MK +G+ K+ G S +E+N EVHEF V D++H +  +I     ++  RL+L GY  +T  V+ D++EEEK + +  HSEK A+ +G+++  +D  IRIVKNLRVC DCH    ++SK++ REIIVRDR RFHH++DG CSC  +W
Sbjct:  194 RKLFEGMPERDPIAWNAMISGYAQVGESREALNVFHLMQLEGVKVNGVAMISVLSACTQLGALDQGRWAHSYIERNKIKITVRLATTLVDLYAKCGDMEKAMEVFWGMEEKNVYTWSSALNGLAMNGFGEKCLELFSLMKQDGVTPNAVTFVSVLRGCSVVGFVDEGQRHFDSMRNEFGIEPQLEHYGCLVDLYARAGRLEDAVSIIQQMPMKPHAAVWSSLLHASRMYKNLELGVLASKKMLELETANHGAYVLLSNIYADSNDWDNVSHVRQSMKSKGVRKQPGCSVMEVNGEVHEFFVGDKSHPKYTQIDAVWKDISRRLRLAGYKADTTPVMFDIDEEEKEDALCLHSEKAAIAFGIMSLKEDVPIRIVKNLRVCGDCHQVSMMISKIFNREIIVRDRNRFHHFKDGHCSCNGFW 612          

HSP 2 Score: 91.6633 bits (226), Expect = 1.945e-18
Identity = 65/264 (24.62%), Postives = 115/264 (43.56%), Query Frame = -2
Query:  664 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILG--IRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYA-------------------------------KCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE 1356
            I D+  +  L + ++MI  + +S  P+++   ++ +   G  ++PD  T+  ++ AC  L + +    +H    + GF     +   LI +YA                               +CG +  AR +FE M  R+ I+W  MI+ +A  G++  AL  F  M+   V+ NGV  + VL AC+  G ++ GR    S I  + I         +VDL  +   + +A+E+   M    NV  W S ++   ++G  E
Sbjct:   62 ILDRSEKPTLFALNSMIRAHCKSPVPEKSFDFYRRILSSGNDLKPDNYTVNFLVQACTGLRMRETGLQVHGMTIRRGFDNDPHVQTGLISLYAELGCLDSCHKVFNSIPCPDFVCRTAMVTACARCGDVVFARKLFEGMPERDPIAWNAMISGYAQVGESREALNVFHLMQLEGVKVNGVAMISVLSACTQLGALDQGRWAH-SYIERNKIKITVRLATTLVDLYAKCGDMEKAMEVFWGME-EKNVYTWSSALNGLAMNGFGE 323          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PPR21_ARATH (Pentatricopeptide repeat-containing protein At1g08070, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 7.152e-135
Identity = 196/419 (46.78%), Postives = 287/419 (68.50%), Query Frame = -2
Query:  106 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADK--NGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1356
            +F+++  KD++SW+ +I GY   +  +EAL LF+E+   G  P+ VTMLS++ ACA+LG +D  +WIHVY DK   G   +  +  +LIDMYAKCG +E A  VF  +  +++ SW  MI  FA+HG A+ +   F +M++  ++P+ +TFVG+L ACSH+G+++ GR IF +M  ++ +TPK EHYGCM+DLLG + L +EA E++  M   P+ VIW SL+ AC++HG  ELGE  A+ ++++EP++ G+ VLLSNIYA   +W  V   R L+ ++G+ K  G S IE+++ VHEF++ D+ H +  EIY  L E+   L+  G+ P+T  VL ++EEE K   +  HSEKLA+ +GLI+    + + IVKNLRVC +CH   KL+SK+Y+REII RDRTRFHH+RDGVCSC DYW
Sbjct:  323 LFERLPYKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLKGVTNASSLRTSLIDMYAKCGDIEAAHQVFNSILHKSLSSWNAMIFGFAMHGRADASFDLFSRMRKIGIQPDDITFVGLLSACSHSGMLDLGRHIFRTMTQDYKMTPKLEHYGCMIDLLGHSGLFKEAEEMINMMEMEPDGVIWCSLLKACKMHGNVELGESFAENLIKIEPENPGSYVLLSNIYASAGRWNEVAKTRALLNDKGMKKVPGCSSIEIDSVVHEFIIGDKFHPRNREIYGMLEEMEVLLEKAGFVPDTSEVLQEMEEEWKEGALRHHSEKLAIAFGLISTKPGTKLTIVKNLRVCRNCHEATKLISKIYKREIIARDRTRFHHFRDGVCSCNDYW 741          

HSP 2 Score: 166.777 bits (421), Expect = 1.805e-43
Identity = 88/258 (34.11%), Postives = 150/258 (58.14%), Query Frame = -2
Query:  592 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINE-HNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHG--ETELGEFTAKRVLELEPDHDGALVLLS 1356
            +FD++  KD+VSW+AMISGYAE+   +EAL LFK++    +RPD+ TM++V+SACA  G ++  + +H++ D +GFG +L+I NALID+Y+KCG LE A  +FE++  ++VISW  +I  +        AL  FQ+M  +   PN VT + +L AC+H G ++ GR I   +      +T        ++D+  +   +  A ++  ++    ++  W +++    +HG  +     F+  R + ++PD    + LLS
Sbjct:  222 LFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHLWIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERLPYKDVISWNTLIGGYTHMNLYKEALLLFQEMLRSGETPNDVTMLSILPACAHLGAIDIGRWIHVYIDKRLKGVTNASSLRTSLIDMYAKCGDIEAAHQVFNSI-LHKSLSSWNAMIFGFAMHGRADASFDLFSRMRKIGIQPDDITFVGLLS 478          

HSP 3 Score: 108.227 bits (269), Expect = 9.072e-24
Identity = 69/254 (27.17%), Postives = 118/254 (46.46%), Query Frame = -2
Query:  688 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWT-------------------------------GMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSA 1356
            +F  + E +L+ W+ M  G+A S  P  AL+L+  +  LG+ P+  T   V+ +CA      + + IH +  K G    L ++ +LI MY + G LE A  VF+K   R+V+S+T                                MI+ +A  G+   AL  F+ M +  V P+  T V V+ AC+ +G +E GR++    I++H      +    ++DL  +   L  A  + E +P+  +V+ W +L+  
Sbjct:   90 VFKTIQEPNLLIWNTMFRGHALSSDPVSALKLYVCMISLGLLPNSYTFPFVLKSCAKSKAFKEGQQIHGHVLKLGCDLDLYVHTSLISMYVQNGRLEDAHKVFDKSPHRDVVSYTALIKGYASRGYIENAQKLFDEIPVKDVVSWNAMISGYAETGNYKEALELFKDMMKTNVRPDESTMVTVVSACAQSGSIELGRQVHL-WIDDHGFGSNLKIVNALIDLYSKCGELETACGLFERLPYK-DVISWNTLIGG 341          
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Match: PP341_ARATH (Pentatricopeptide repeat-containing protein At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 6.092e-134
Identity = 190/419 (45.35%), Postives = 273/419 (65.16%), Query Frame = -2
Query:  106 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLMKERGISKERGYSRIELNNEVHEFLVADRNHKQAYEIYEKLNEVVSRLKLDGYAPNTGCVLVDLEEEEKREVVLWHSEKLALCYGLINGAKDSCIRIVKNLRVCEDCHTFLKLVSKVYRREIIVRDRTRFHHYRDGVCSCRDYW 1362
            R +FD+  EK L SW+AMISGY ++   ++A+ LF+E+Q     P+ VT+  ++SACA LG L   KW+H       F  S+ ++ ALI MYAKCGS+  AR +F+ MT +N ++W  MI+ + +HG    AL  F +M  + + P  VTF+ VLYACSHAGLV++G +IF SMI+ +   P  +HY CMVD+LGRA  L+ A++ +E M   P   +W +L+ AC+IH +T L    ++++ EL+PD+ G  VLLSNI++ +R +     +RQ  K+R ++K  GY+ IE+    H F   D++H Q  EIYEKL ++  +++  GY P T   L D+EEEE+  +V  HSE+LA+ +GLI     + IRI+KNLRVC DCHT  KL+SK+  R I+VRD  RFHH++DGVCSC DYW
Sbjct:  374 RKLFDESPEKSLPSWNAMISGYTQNGLTEDAISLFREMQKSEFSPNPVTITCILSACAQLGALSLGKWVHDLVRSTDFESSIYVSTALIGMYAKCGSIAEARRLFDLMTKKNEVTWNTMISGYGLHGQGQEALNIFYEMLNSGITPTPVTFLCVLYACSHAGLVKEGDEIFNSMIHRYGFEPSVKHYACMVDILGRAGHLQRALQFIEAMSIEPGSSVWETLLGACRIHKDTNLARTVSEKLFELDPDNVGYHVLLSNIHSADRNYPQAATVRQTAKKRKLAKAPGYTLIEIGETPHVFTSGDQSHPQVKEIYEKLEKLEGKMREAGYQPETELALHDVEEEERELMVKVHSERLAIAFGLIATEPGTEIRIIKNLRVCLDCHTVTKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 792          

HSP 2 Score: 104.76 bits (260), Expect = 1.165e-22
Identity = 58/231 (25.11%), Postives = 120/231 (51.95%), Query Frame = -2
Query:  664 IFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKELQILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMPFAPNVVIWGSLMSACQIHGETE 1356
            +F +  + D+V+++AMI GY  + + + +L LFKEL + G R    T++S++    +L ++     IH Y  K+ F     ++ AL  +Y+K   +E AR +F++   +++ SW  MI+ +  +G   +A+  F++M+++   PN VT   +L AC+  G +  G+ +   ++   +          ++ +  +   + EA  + + M    N V W +++S   +HG+ +
Sbjct:  278 LFREFRKPDIVAYNAMIHGYTSNGETELSLSLFKELMLSGARLRSSTLVSLVPVSGHLMLIYA---IHGYCLKSNFLSHASVSTALTTVYSKLNEIESARKLFDESPEKSLPSWNAMISGYTQNGLTEDAISLFREMQKSEFSPNPVTITCILSACAQLGALSLGKWVH-DLVRSTDFESSIYVSTALIGMYAKCGSIAEARRLFDLMT-KKNEVTWNTMISGYGLHGQGQ 503          

HSP 3 Score: 86.2705 bits (212), Expect = 1.404e-16
Identity = 70/312 (22.44%), Postives = 135/312 (43.27%), Query Frame = -2
Query:  535 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKEL-QILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKMKEARVEPNGVTFVG---------VLYAC----------SHAGL-------------VEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEIVETMP---FAPNVVIWGSLMSACQIHGETELGEFTAKRVLELEPDHDGALVLLSNIYAKERKWQNVGDLRQLM 1362
            R +FD+M EKD + W+ MISGY +++   E++++F++L      R D  T+L ++ A A L  L     IH  A K G      +    I +Y+KCG ++    +F +    +++++  MI+ +  +G+   +L  F+++  +       T V          ++YA           SHA +             +E  RK+F     + +       +  M+    +  L  +A+ +   M    F+PN V    ++SAC   G   LG++    V     D + ++ + + +     K  ++ + R+L 
Sbjct:  174 RKVFDRMPEKDTILWNTMISGYRKNEMYVESIQVFRDLINESCTRLDTTTLLDILPAVAELQELRLGMQIHSLATKTGCYSHDYVLTGFISLYSKCGKIKMGSALFREFRKPDIVAYNAMIHGYTSNGETELSLSLFKELMLSGARLRSSTLVSLVPVSGHLMLIYAIHGYCLKSNFLSHASVSTALTTVYSKLNEIESARKLF-----DESPEKSLPSWNAMISGYTQNGLTEDAISLFREMQKSEFSPNPVTITCILSACAQLGALSLGKWVHDLV--RSTDFESSIYVSTALIGMYAKCGSIAEARRLF 478          

HSP 4 Score: 58.9214 bits (141), Expect = 6.326e-8
Identity = 54/242 (22.31%), Postives = 111/242 (45.87%), Query Frame = -2
Query:  658 RLIFDQMVEKDLVSWSAMISGYAESDQPQEALRLFKEL-QILGIRPDQVTMLSVISACANLGVLDKAKWIHVYADKNGFGGSLRINNALIDMYAKCGSLERARNVFEKMTSRNVISWTGMINAFAIHGDANNALRYFQKM-KEARVEPNGVTFVGVLYACSHAGLVEDGRKIFASMINEHNITPKHEHYGCMVDLLGRANLLREAVEI-VETMPF----APNVVIWGSLMSACQIHGETELG 1362
            R IF  +   D+  ++ ++ G++ ++ P  +L +F  L +   ++P+  T    ISA +        + IH  A  +G    L + + ++ MY K   +E AR VF++M  ++ I W  MI+ +  +     +++ F+ +  E+    +  T + +L A +    +  G +I       H++  K   Y     L G  +L  +  +I + +  F     P++V + +++     +GETEL 
Sbjct:   72 RDIFLSVQRPDVFLFNVLMRGFSVNESPHSSLSVFAHLRKSTDLKPNSSTYAFAISAASGFRDDRAGRVIHGQAVVDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMPEKDTILWNTMISGYRKNEMYVESIQVFRDLINESCTRLDTTTLLDILPAVAELQELRLGMQI-------HSLATKTGCYSHDYVLTGFISLYSKCGKIKMGSALFREFRKPDIVAYNAMIHGYTSNGETELS 306          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NLW2_GOSAR1.481e-26100.00Pentatricopeptide repeat-containing-like protein O... [more]
A0A0D2T7B3_GOSRA7.409e-2696.18Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EMY0_THECC5.460e-2687.59Pentatricopeptide repeat (PPR) superfamily protein... [more]
B9HUV1_POPTR2.719e-2779.95Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A067GGS0_CITSI1.653e-2876.61Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4S8H9_9ROSI4.508e-2876.13Uncharacterized protein OS=Citrus clementina GN=CI... [more]
W9R134_9ROSA1.539e-3177.80Uncharacterized protein OS=Morus notabilis GN=L484... [more]
D7T700_VITVI9.781e-3277.33Putative uncharacterized protein OS=Vitis vinifera... [more]
A0A067L6S3_JATCU1.736e-3276.13Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A059D1A8_EUCGR9.737e-2873.03Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010582 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PP311_ARATH1.063e-2568.00Pentatricopeptide repeat-containing protein At4g14... [more]
PP330_ARATH2.381e-15148.33Pentatricopeptide repeat-containing protein At4g21... [more]
PP175_ARATH1.787e-14648.69Pentatricopeptide repeat-containing protein At2g29... [more]
PP425_ARATH2.999e-14347.73Pentatricopeptide repeat-containing protein At5g48... [more]
PP449_ARATH3.319e-13946.89Pentatricopeptide repeat-containing protein At5g66... [more]
PP145_ARATH3.952e-13945.48Pentatricopeptide repeat-containing protein At2g02... [more]
PP354_ARATH3.145e-13846.32Pentatricopeptide repeat-containing protein ELI1, ... [more]
PP410_ARATH1.041e-13545.58Putative pentatricopeptide repeat-containing prote... [more]
PPR21_ARATH7.152e-13546.78Pentatricopeptide repeat-containing protein At1g08... [more]
PP341_ARATH6.092e-13445.35Pentatricopeptide repeat-containing protein At4g30... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002885Pentatricopeptide repeatPFAMPF13041PPR_2coord: 111..157
e-value: 1.6E-8
score: 34.5
coord: 9..57
e-value: 5.5E-10
score: 39.2
IPR002885Pentatricopeptide repeatPFAMPF01535PPRcoord: 185..209
e-value: 0.22
score: 11.7
IPR002885Pentatricopeptide repeatTIGRFAMTIGR00756TIGR00756coord: 113..146
e-value: 6.0E-6
score: 24.1
coord: 85..112
e-value: 1.5E-4
score: 19.7
coord: 12..45
e-value: 6.8E-7
score: 27.1
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 214..244
score: 5.064
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 146..181
score: 8.002
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 248..282
score: 5.711
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 80..110
score: 8.714
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 45..79
score: 6.884
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 10..44
score: 12.288
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 111..145
score: 10.841
IPR002885Pentatricopeptide repeatPROSITEPS51375PPRcoord: 182..212
score: 5.974
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 11..142
e-value: 3.9E-9
score: 35.0
coord: 212..265
e-value: 3.9E-9
score: 35.0
IPR011990Tetratricopeptide-like helical domainSUPERFAMILY48452TPR-likecoord: 90..135
coord: 229..265
coord: 295..317
IPR032867DYW domainPFAMPF14432DYW_deaminasecoord: 285..407
e-value: 3.2E-36
score: 123.9
NoneNo IPR availablePANTHERPTHR24015FAMILY NOT NAMEDcoord: 1..289
NoneNo IPR availablePANTHERPTHR24015:SF581SUBFAMILY NOT NAMEDcoord: 1..289

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010582 ID=g.arboreum_cottongen_reftransV1_0010582|Name=g.arboreum_cottongen_reftransV1_0010582|organism=Gossypium arboreum|type=contig|length=1363bp
TTGGAGAGCAGTCATGTTCCAAGCAACTCACTGTTGGTATTCCAATACAA
ATTTTACCATAATCCATAAACAATTCCGAGCAGAGAAAAGGCTCAAGAAA
CATCACCAATAGTCTCTGCAAGAACAAACTCCATCTCTGTAATGGTGGAA
CCTTGTCCTATCCCTGACAATAATTTCCCTCCTATACACCTTCGAAACTA
ACTTCAAAAAGGTATGGCAGTCCTCGCAAACTCGAAGATTCTTAACTATC
CGAATGCATGAATCTTTTGCCCCATTTATGAGTCCATAACAAAGTGCTAA
CTTCTCACTATGCCATAGAACCACCTCCCTTTTTTCTTCCTCTTCTAAGT
CAACAAGAACACAACCGGTATTTGGAGCATAGCCATCCAACTTCAATCGA
CTAACCACCTCATTCAATTTTTCATATATCTCATACGCTTGTTTGTGATT
CCTATCTGCCACTAAAAACTCATGCACCTCATTGTTCAATTCAATCCTAC
TATATCCCCTTTCCTTAGATATACCTCTTTCTTTCATTAATTGCCTCAAG
TCTCCAACATTTTGCCATTTTCTTTCTTTGGCATAAATATTTGATAGTAG
AACAAGAGCCCCATCATGATCTGGCTCAAGCTCGAGTACCCTTTTGGCAG
TGAATTCTCCTAATTCAGTCTCACCATGAATTTGACAAGCAGACATGAGG
GATCCCCAAATGACAACATTGGGTGCAAAAGGCATCGTCTCTACAATCTC
AACTGCTTCTCTCAAGAGATTAGCACGGCCAAGGAGGTCAACCATGCAAC
CATAATGTTCATGTTTAGGAGTGATATTGTGTTCATTAATCATGGATGCA
AAGATCTTTCGGCCATCCTCAACCAGCCCTGCATGGCTACAAGCATAAAG
CACGCCCACAAATGTAACTCCATTTGGCTCAACACGAGCCTCTTTCATTT
TCTGAAAGTATCTTAAAGCATTATTGGCATCCCCATGTATAGCAAATGCA
TTGATCATACCGGTCCAAGATATCACATTTCTGCTTGTCATTTTCTCAAA
AACATTTCTTGCTCTTTCCAAACTCCCACATTTGGCATACATGTCAATAA
GAGCATTATTAATACGTAAACTTCCTCCAAAACCGTTCTTATCAGCATAT
ACATGTATCCATTTAGCTTTATCTAGTACACCCAGATTTGCACAAGCTGA
TATAACACTCAGCATGGTCACCTGATCAGGTCTTATTCCTAGTATTTGCA
GTTCCTTAAACAATCTAAGAGCCTCTTGAGGTTGATCACTCTCAGCATAA
CCAGATATCATTGCACTCCAAGACACCAAGTCCTTCTCTACCATTTGGTC
AAAAATCAATCGA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR002885Pentatricopeptide_repeat
IPR011990TPR-like_helical_dom_sf
IPR032867DYW_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding