g.arboreum_cottongen_reftransV1_0000053, g.arboreum_cottongen_reftransV1_0000053 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0000053
Unique Nameg.arboreum_cottongen_reftransV1_0000053
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length6584
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr10chromosomeg.arboreum_cottongen_reftransV1_0000053:1..6584 .
Chr10:87614981..87638251 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A0D2TNR6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G117700 PE=4 SV=1)

HSP 1 Score: 3822.71 bits (9912), Expect = 0.000e+0
Identity = 1981/2010 (98.56%), Postives = 1989/2010 (98.96%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGP EES+ADTPQEIDEYELVDPVDILTPLEKSGFWDGVKA KWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGG  S+       FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAI  LKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLI+FCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR SEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTT+GNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLS LDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKS DVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGL SKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHL PRML GVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETF ARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTED RG+GNA+NTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGN+DDYGTRPLMSVNDNLNLGLS+QTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL
Sbjct:   15 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPAEESVADTPQEIDEYELVDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGGLSSTEVSEGS-FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAISLLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIEFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRASEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTIGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSALDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSVDVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLASKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLMPRMLAGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFVARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDYRGAGNAINTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNMDDYGTRPLMSVNDNLNLGLSTQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 2023          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A0D2RZ17_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G117700 PE=4 SV=1)

HSP 1 Score: 3813.08 bits (9887), Expect = 0.000e+0
Identity = 1978/2010 (98.41%), Postives = 1987/2010 (98.86%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGP EES+ADTPQEIDEYELVDPVDILTPLEKSGFWDGVKA KWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGG  S+       FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAI  LKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLI+FCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR SEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTT+GNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLS LDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKS DVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGL SKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHL PRML GVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETF ARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTED RG+GNA+NTARVRAPENALADQRNERFI  +TSGTLDAIRERMKSMQLAAAGGN+DDYGTRPLMSVNDNLNLGLS+QTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL
Sbjct:   15 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPAEESVADTPQEIDEYELVDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGGLSSTEVSEGS-FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAISLLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIEFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRASEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTIGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSALDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSVDVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLASKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLMPRMLAGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFVARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDYRGAGNAINTARVRAPENALADQRNERFI--ITSGTLDAIRERMKSMQLAAAGGNMDDYGTRPLMSVNDNLNLGLSTQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 2021          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A0D2QE35_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G117700 PE=4 SV=1)

HSP 1 Score: 3633.96 bits (9422), Expect = 0.000e+0
Identity = 1891/1918 (98.59%), Postives = 1897/1918 (98.91%), Query Frame = -1
Query:  642 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISG 6395
            PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGP EES+ADTPQEIDEYELVDPVDILTPLEKSGFWDGVKA KWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGG  S+       FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAI  LKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLI+FCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR SEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTT+GNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLS LDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKS DVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGL SKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHL PRML GVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETF ARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTED RG+GNA+NTARVRAPENALADQRNERFISG
Sbjct:   15 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPAEESVADTPQEIDEYELVDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNSGGGLSSTEVSEGS-FVKKSAASMLSGKRPAPAAPANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAISLLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNVQVQQQVIEVITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIEFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRASEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTIGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSALDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSVDVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLASKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTISRKNYVQPDLNMERHLMPRMLAGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKENTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFVARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDYRGAGNAINTARVRAPENALADQRNERFISG 1931          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A061GFC7_THECC (ARM repeat superfamily protein OS=Theobroma cacao GN=TCM_027100 PE=4 SV=1)

HSP 1 Score: 3500.68 bits (9076), Expect = 0.000e+0
Identity = 1827/2016 (90.62%), Postives = 1906/2016 (94.54%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLA+LCDSITDPKDSRLRE+APFF+KTVADSNAPVQEKALDALIAFLKAADADAGRY KEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAV+ FLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTG AKPSRKIRSEQDREPE EAVSEAAGPGP EES  +TPQEIDEYELVDPVDILTPLEKSGFWDGVKA KWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQA+GNLARGLRTHF+GSSRFLL VLLEKLKEKKP LTESLTQTLQ MHKAGCLNLADIVEDVKTA+KNKVPLVRSLTLNWVTFCIETSNKAV+LKVHKDYV ICMECLNDGTPDVRDAAFSAL AVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSG++V   TSSAAV+NSGGG  S+       FV++SAASMLSGKRP P APANKKG S KSGN+KKV+GAGR ETAK +E+PEDIEPAEMSLEEIESR+GSLIQAD +SQLKSAVWKERLEAI  LK+QVEG+QDLD+SVEIL+ LLCA+PGWNEKNVQVQQQVIE++TYLA++A+K PKKCVVLCLLGISERVAD+KTRAHAMKCLT FSE+VGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSA++DFGVSHLKLKDLID CKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALD EY+KNPFEGTS  PKKTV+  E +SLS GGLDGLPREDIS KITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTT+G VASA+GP VEKASKGILSDILKCL DNKKHMRESTLSTLDAWNAAVHFDKMVPYITSAL D+KLGAEGRKDLFDWSSRQLSGLSEF D VHLLK AATAMMDKS+DVRKAA+GC+ EILRVSGQE IEKNL+DIQGPALALILER+KPYGSFQE +E SKG S GL SKTN KV K+TSNGVTKHGNR VTSRAIP K L+P+TML VQ I+VQ QALLNVKDSNKEERERM VRR KFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQ CKSNTTCLLKVLEFLPELF+SLKGEAY+LTE+EAAIFLPCL EK+GHNIEKVREKMREL KQIVQ+YSA+K Y YIL+GLRSKNNRTRIECVDLVGF IDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILG+DIWRYVGKLT+AQKSMLDDRFKWKVREMEKR EGRPGEARAALRRSVREN PDVAEQS EV Q++S     RKNY QPDLNMERHL PR+L GV+GP+NWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDEL KDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKE+TLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPA+NETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTST PGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+PMSTPPPASL++SSPEF PLSPV TNS NDSK  +TK +PT+F LPPSYTEDNR +GNA+NT RV   ENALADQRNER +SGVTSGTLDAIRERMKSMQLAAA GNI DYGTRPLMSVND+LNLGLS+QTR LD HP +ENPAQGGVLPMDEKALSGLQARMERLKS GALEPL
Sbjct:   16 PWEDRLLHKNWKVRNEANIDLASLCDSITDPKDSRLREIAPFFRKTVADSNAPVQEKALDALIAFLKAADADAGRYAKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVDVFLDSMEKAIKNKVAKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGTAKPSRKIRSEQDREPEHEAVSEAAGPGPVEESADNTPQEIDEYELVDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAVGNLARGLRTHFAGSSRFLLTVLLEKLKEKKPALTESLTQTLQAMHKAGCLNLADIVEDVKTATKNKVPLVRSLTLNWVTFCIETSNKAVILKVHKDYVSICMECLNDGTPDVRDAAFSALAAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGAAVSANTSSAAVQNSGGGVSSTEVSEGS-FVRRSAASMLSGKRPVPVAPANKKGASVKSGNNKKVEGAGRPETAKLTEAPEDIEPAEMSLEEIESRLGSLIQADTVSQLKSAVWKERLEAISLLKQQVEGIQDLDKSVEILIRLLCAVPGWNEKNVQVQQQVIEIVTYLASTASKLPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSESVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAVDDFGVSHLKLKDLIDLCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDAEYEKNPFEGTSAIPKKTVKALESTSLSVGGLDGLPREDISGKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTIGGVASALGPAVEKASKGILSDILKCLGDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALIDTKLGAEGRKDLFDWSSRQLSGLSEFSDGVHLLKSAATAMMDKSSDVRKAAEGCIGEILRVSGQEIIEKNLKDIQGPALALILERIKPYGSFQESLESSKGVSTGLASKTNAKVVKSTSNGVTKHGNRAVTSRAIPTKALRPETMLSVQDIAVQSQALLNVKDSNKEERERMVVRRFKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPELFESLKGEAYALTESEAAIFLPCLIEKVGHNIEKVREKMRELAKQIVQMYSASKSYPYILEGLRSKNNRTRIECVDLVGFLIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGEDIWRYVGKLTEAQKSMLDDRFKWKVREMEKRREGRPGEARAALRRSVRENAPDVAEQSGEVSQSVSGSIFARKNYGQPDLNMERHLMPRVLGGVTGPTNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELEKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKESTLDNLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPASNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTSPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPASLTASSPEFAPLSPVHTNSANDSKSLNTKSDPTNFTLPPSYTEDNR-AGNAINT-RVLGSENALADQRNERVMSGVTSGTLDAIRERMKSMQLAAAAGNI-DYGTRPLMSVNDSLNLGLSTQTRPLD-HPAIENPAQGGVLPMDEKALSGLQARMERLKS-GALEPL 2025          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: B9GIF2_POPTR (MICROTUBULE ORGANIZATION 1 family protein OS=Populus trichocarpa GN=POPTR_0001s43380g PE=4 SV=1)

HSP 1 Score: 3229.88 bits (8373), Expect = 0.000e+0
Identity = 1691/2026 (83.46%), Postives = 1829/2026 (90.28%), Query Frame = -1
Query:  366 WEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVED-----VKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEP-SSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQ----ELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6392
            WEDRL HKNWKVRNEANIDLA+LCDSI+DPKDSRLRE AP F+KTVADSNAPVQEKALDALIAFL+AADADAGRY KEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAV+ FLD+MEKAIKNKVAKAVVPAIDVMFQALS+FGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNV G AKPSRKIRSEQD+EPEPE VSE  G GP+EE  A+ PQEIDEY+LVDPVDIL PLEK+GFWDGVKA KWSERKEAVAELTKLASTK+IAPGDF+EVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTE+L QTLQ MH AGCLNLADI+E      VKTA KNKVPLVRSLTLNWVTFCIETSNKAV+LKVHKDYVPICMECLNDGTPDVRD+AFS L AVAKSVGMRPLERSLEKLDDVR+KKLSEMIAGSG  VP   SS  V+ +  G +SS E SEGSFVKKSAASMLSGKRPAPAA ANKK    KSG SKK DGAGR E++++ E PED+EPAEMSLEEIE+R+GSLIQAD +SQLKSAVWKERLEAI S K QVEGLQ+LD+SVEIL+ LLCAIPGWNEKNVQVQQQVIEVITYLA++A+KFPKKCVVLCLLGISERVAD+KTRAHAMKCLT FSEAVGPGFVF+RLYKIMKEHKNPKVLSEG++WMVSAI+DFGVSHLKLKDLIDFCKDTGLQSS AA+RNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY KNPFEG S APKKTVR SE  SS+S GGLD LPREDIS KITPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNL+M  LTT+G VASAMGP VEK+SKG+LSDILKCL DNKKHMRE TL+TLD+W AAVH DKMVPYIT+AL ++KLGAEGRKDLFDW S+QLSG SEF DA+HLLKPA++AM DKS+DVRKAA+ C++EILRV GQE IEKNL+DIQGPALAL+LERV+P G FQ    E  E +K  S+G  SKT+ KV KA SNG++KH NR++++R IP KG KP+  +  Q  +VQ QALLNVKDSNKE+RERM VRR KFEEPR+EQ+QDLE+DMMKYFREDL+RRLLS DFKKQVDGLEML KALPSIGKEIIEVLDILLRWFVLQ CKSNTTCLLKVLEFLP+LFD L+ EAY+L+E+EAAIFLPCL EKLGHNIEKVREKMRELTKQIVQ YSA K + YIL+GLRSKNNRTRIEC DLVGF IDHHGAEISGQLKSLQIVASLTAERDGE RKAALNTLATGYKILG+DIWR++GKLTDAQKSM+DDRFKWKVREMEKR EGRPG+ARAALRRSVRENG D+AEQS E+ Q++S     RKNY   +L+ME H+ PR LV V+GP++WNEALDIISFGSPEQSVEGMKVVCHEL QATND EGS MDEL+KDAD+LVSCLANKV++TFDFSLTGASSR+CKYVLNTLMQTFQNK LA+AVKE+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDP+RWPSPA+ ETFA RNQKFSDLVVKCLIKLTKVLQ+TIYDVDLDRILQSIH+YLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTST P GQ HWGDS ANN +PA +SA+AQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+P+STPPP++L+ SSP+  PLSPV TNSLND+K    KPE T+F+LPPSY EDNR     ++   V   EN+L DQRNE+ I GVTSGTLDAIRERMKSMQLAAA GN  D G+RPLMS+N+NLN GLSSQ        GMENP   GVLPMDEKALSGLQARMERLKS G+LEPL
Sbjct:   16 WEDRLLHKNWKVRNEANIDLASLCDSISDPKDSRLREFAPLFRKTVADSNAPVQEKALDALIAFLRAADADAGRYAKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVDVFLDAMEKAIKNKVAKAVVPAIDVMFQALSDFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVKGTAKPSRKIRSEQDKEPEPEGVSEVVGSGPSEEVAAEAPQEIDEYDLVDPVDILGPLEKAGFWDGVKATKWSERKEAVAELTKLASTKRIAPGDFSEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTLTEALAQTLQAMHTAGCLNLADIIEGNLRDYVKTAVKNKVPLVRSLTLNWVTFCIETSNKAVILKVHKDYVPICMECLNDGTPDVRDSAFSVLAAVAKSVGMRPLERSLEKLDDVRRKKLSEMIAGSGDGVPAVASSGPVQ-AVRGSMSSVETSEGSFVKKSAASMLSGKRPAPAAAANKKAAPTKSGVSKKGDGAGRAESSRAIEPPEDVEPAEMSLEEIETRLGSLIQADTVSQLKSAVWKERLEAISSFKLQVEGLQNLDQSVEILIRLLCAIPGWNEKNVQVQQQVIEVITYLASTASKFPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSEAVGPGFVFDRLYKIMKEHKNPKVLSEGIIWMVSAIDDFGVSHLKLKDLIDFCKDTGLQSSVAASRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDAEYDKNPFEGASAAPKKTVRTSESTSSVSGGGLDSLPREDISGKITPTLIKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLIMTALTTIGGVASAMGPAVEKSSKGVLSDILKCLGDNKKHMRECTLNTLDSWVAAVHLDKMVPYITAALIETKLGAEGRKDLFDWLSKQLSGSSEFSDAIHLLKPASSAMTDKSSDVRKAAEACISEILRVCGQEMIEKNLKDIQGPALALVLERVRPAGGFQGLSFESFESTKTISMGPSSKTSVKVGKAASNGISKHANRSISARVIPMKGSKPEPTMSFQDRAVQSQALLNVKDSNKEDRERMVVRRFKFEEPRMEQVQDLESDMMKYFREDLNRRLLSPDFKKQVDGLEMLHKALPSIGKEIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPDLFDRLRDEAYTLSESEAAIFLPCLIEKLGHNIEKVREKMRELTKQIVQAYSAAKSFPYILEGLRSKNNRTRIECADLVGFLIDHHGAEISGQLKSLQIVASLTAERDGETRKAALNTLATGYKILGEDIWRFLGKLTDAQKSMIDDRFKWKVREMEKRKEGRPGDARAALRRSVRENGSDIAEQSGELSQSVSGPIIARKNYGTQELHMEGHMMPRALVSVNGPADWNEALDIISFGSPEQSVEGMKVVCHELAQATNDAEGSAMDELVKDADKLVSCLANKVSRTFDFSLTGASSRACKYVLNTLMQTFQNKILAYAVKESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPTRWPSPASAETFAIRNQKFSDLVVKCLIKLTKVLQTTIYDVDLDRILQSIHIYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTAPVGQNHWGDSAANNSSPAAHSAEAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPISTPPPSALNVSSPDLQPLSPVHTNSLNDAKPLHVKPETTNFHLPPSYAEDNRAVSAFLSRGLVS--ENSLGDQRNEKLIGGVTSGTLDAIRERMKSMQLAAATGN-PDSGSRPLMSMNENLNNGLSSQILRAPDSTGMENPLHSGVLPMDEKALSGLQARMERLKS-GSLEPL 2036          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: V4UCX1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10014013mg PE=4 SV=1)

HSP 1 Score: 3214.86 bits (8334), Expect = 0.000e+0
Identity = 1685/2018 (83.50%), Postives = 1827/2018 (90.54%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEP-SSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLAALCDSITDPKD+R+REL P FKKTVADSNAPVQ+KALDALIA+LKAADADAGRY KEVCDAI AKCLTGRPKTVEKAQA FMLWVELEAV+ FLD MEKAIKNKVAKAVVPAIDVMFQALSEFGAK++PPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVK+ILFEKMRDTMKKELEAELVNV+G A+P+RKIR+EQD+E   E +SE  GPGP+EES AD P EIDEYELVDPVDILTPLEKSGFW+GVKA KWSERK+A+AELTKLASTK+IAPGDFTEVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPT+ ESLTQTLQ MHKAGCLNL D+VEDVKT+ KNKVPLVRSLTLNWVTFC+ETS+KAVVLKVHKDYVPICMECLNDGTP+VRDAAFS L A+AKSVGMRPLERS+EKLDDVR+ KLSEMIAG+G  V   TSSA V+ SGG   S        FV+KSAASMLSGKRP  AAPA+KKG   K   S K DG+G+ ET+K +E+PED+EP+EMSLEEIESR+GS I AD + QLKSAVWKERLEAI SL++QVE +Q+LD+SVEILV L+C +PGW+EKNVQVQQQVIEVI YLA +A KFPKKCVVLCLLGISERVAD+KTRAHAMKCLT FSEAVGPGF+FERLYKIMK+HKNPKVLSEG+LWMVSA+EDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEGT   PKKTVR SE  SS+SAGG DGLPREDIS KITPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQP GTGELFG LRGRLYDSNKNLVMATLTT+G VASAMGP VEK+SKG+LSDILKCL DNKK+MRE TL+ LDAW AAVH DKMVPY+T+ALTD+KLGAEGRKDLFDW S+QL+GLS FPDA HLLKPA+ AM DKS+DVRKAA+ C+ EILR  GQE IEKNL+DIQGPALALILER+K  G+ Q         S+G  SK+++KV K+ SNG++KHGNR V+SR IP KG +P++++ VQ  +VQ QALLNVKDSNKE+RERM VRR KFE+PRIEQIQ+LENDMMKYFREDLHRRLLS DFKKQVDGLEMLQKALPSI K+IIEVLDILLRWFVLQ CKSNTTCLLKVLEFLPELFD+L+ E YSL E+EAA+FLPCL EK GHNIEKVREKMRELTKQIV  YSATK   YIL+GLRSKNNRTRIECVDLVGF IDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILG+DIWRYVGKLTDAQKSMLDDRFKWKVREMEK+ EG+PGEARAALRRSVRENG D+AEQS +V Q++S     R+NY   +L++ER + PR L  VSGP++WNEALDIISFGSPEQSVEGMKVVCHEL QATNDPEGS+MDEL+KDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLA+AV+E+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPA+NE+FAARNQ+FSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTSTGP GQTHWGDS ANNP  ATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPM+TPPPA+L  SSPEF PLSPV TNS+ND+K  + K EPT+FNLPPSYTEDNR  G A+  ++V  PEN L+DQRNERF  GVTSGTLDAIRERMKSMQLAAA GN  D G RPL+++NDN+N GLSSQ+R+ D    +ENPAQG VLPMDEKALSGLQARMERLKS G +EPL
Sbjct:   15 PWEDRLLHKNWKVRNEANIDLAALCDSITDPKDNRIRELGPLFKKTVADSNAPVQDKALDALIAYLKAADADAGRYAKEVCDAIAAKCLTGRPKTVEKAQAVFMLWVELEAVDVFLDVMEKAIKNKVAKAVVPAIDVMFQALSEFGAKIIPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKTILFEKMRDTMKKELEAELVNVSGTARPTRKIRAEQDKELGQELISEDVGPGPSEESTADVPPEIDEYELVDPVDILTPLEKSGFWEGVKATKWSERKDAIAELTKLASTKRIAPGDFTEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTVAESLTQTLQAMHKAGCLNLVDVVEDVKTSVKNKVPLVRSLTLNWVTFCVETSSKAVVLKVHKDYVPICMECLNDGTPEVRDAAFSVLAAIAKSVGMRPLERSIEKLDDVRRNKLSEMIAGAGGDVATGTSSARVQTSGGSVPSVEASESS-FVRKSAASMLSGKRPVSAAPASKKGGPVKP--SAKKDGSGKQETSKLTEAPEDVEPSEMSLEEIESRLGSRIPADTVGQLKSAVWKERLEAISSLRQQVEAVQNLDQSVEILVRLVCMLPGWSEKNVQVQQQVIEVINYLAATATKFPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSEAVGPGFIFERLYKIMKDHKNPKVLSEGILWMVSAVEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDTEYEKNPFEGT-VVPKKTVRASESTSSVSAGGSDGLPREDISGKITPTLVKSLESPDWKVRLESIEAVNKILEEANKRIQPAGTGELFGGLRGRLYDSNKNLVMATLTTLGAVASAMGPAVEKSSKGVLSDILKCLGDNKKNMRECTLTVLDAWLAAVHLDKMVPYVTTALTDAKLGAEGRKDLFDWLSKQLTGLSGFPDAAHLLKPASIAMTDKSSDVRKAAEACIVEILRAGGQETIEKNLKDIQGPALALILERIKLNGASQV--------SMGPTSKSSSKVPKSASNGLSKHGNRAVSSRVIPTKGARPESIMSVQDFAVQSQALLNVKDSNKEDRERMVVRRFKFEDPRIEQIQELENDMMKYFREDLHRRLLSIDFKKQVDGLEMLQKALPSIRKDIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPELFDTLRDEGYSLPESEAAVFLPCLVEKSGHNIEKVREKMRELTKQIVNFYSATKTLPYILEGLRSKNNRTRIECVDLVGFLIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGEDIWRYVGKLTDAQKSMLDDRFKWKVREMEKKKEGKPGEARAALRRSVRENGSDIAEQSGDVSQSVSGPTFMRRNYGHSELHVERSIMPRALASVSGPTDWNEALDIISFGSPEQSVEGMKVVCHELAQATNDPEGSVMDELVKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAYAVQESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPASNESFAARNQRFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGGQTHWGDSAANNPTSATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVHTNSMNDAKSMNVKSEPTNFNLPPSYTEDNR-IGGAI-ASKVLPPENPLSDQRNERF--GVTSGTLDAIRERMKSMQLAAAAGN-PDPGNRPLINMNDNVNNGLSSQSRSSD-RASVENPAQGSVLPMDEKALSGLQARMERLKS-GTIEPL 2013          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: B9I0T7_POPTR (MICROTUBULE ORGANIZATION 1 family protein OS=Populus trichocarpa GN=POPTR_0011s15690g PE=4 SV=2)

HSP 1 Score: 3213.71 bits (8331), Expect = 0.000e+0
Identity = 1682/2020 (83.27%), Postives = 1814/2020 (89.80%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADI--VEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEP-SSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLA+LC SI DPKDSRLRE AP F+KTVADSNAPVQEKALDALIAFL+AADADAGRY KEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLD+MEKAIKNKV+KAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSIL EKMRDTMKKELEAELVNVTG AKPSRKIRSEQD+EPEPE VSE AGPG +EE   D PQEIDEY+L+DPVDIL+PLEKSGFWDGVKA KWSERKEAVAELTKLASTK+IAPGDF+EVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLR+HFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQ MHKAGC NLADI  VE VKTA KNKVPLVRSLTLNWVTFCIETSNKAV+LKVHKDYVPICME LNDGTPDVRD+AFS L AVAK VGMRPLERSLEKLDDVR+KKLSEMIAGSG  V    +S  V+    G +SS E SE SFVKKSAASMLSGKRPAPAAPANKK    KSG SKKVDGAGR ET+++ E PED+EPAEMSLEEIE+R+GSLIQAD ISQLKSAVWKERLEAI SLKEQVEGLQ+ ++SVEIL+ LLCAIPGWNEKNVQVQQQ IEVITYLA++A+KFPKKCVVLCLLGISERVAD+KTRA+AMKCLT F+EAVGPGFVF+RLYKIMKEHKNPKVLSEG+LWMV AI+DFGVSHLKLKDLIDFCKDTGLQSS AA+RNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEG S  PKKTVR SE  + +S GGLD LPREDIS K+TPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQP GTGELFGALRGRLYDSNKNL+M  LTT+G VASAMGP VEK+SKG+LSDILKCL DNKKHMRE  L+TLD+W AAVH DKM+PYIT+AL +SKLGAEGRKDLFDW S+QLSGLSEFPDA+HLLKPA +AM DKSADVRKAA+ C++EILRV GQE IE+NL+DI GPALAL+LERV+P   +QE  E +K  S+G  SKT++KV KA SNG++KH NR+++SR IP KG KP+  + +Q  +VQ QALLNVKDSNKE+RERM VRR KFEEPR+EQIQDLE DMMKY REDL+RRLLS DFKKQVDGLEMLQKALPSIG EIIEVLDILL+WFVLQ CKSNTTCLLKVLEFLP LFD L+ EAY+L+E+EAAIFLPCL EKLGHNIEKVREKMREL KQI+  YSATK + YIL+GLRSKNNRTRIEC DLVGF ID HGAEISGQLKSLQIVASLTAERDGEIRKAALN LATGYKILG+DIWRY+GKLTDAQKSM+DDRFKWKVREMEKR EGRPG+ARAALRRSVRENG D+AEQS EV Q++S     RKN+   +L +ERH+ PR L   SGP++WNEALDIISF SPEQSVEGMKVVCHEL QAT+D EGS+MDEL+KDADRLVSCLANKVA+TFDFSLTGASSRSCKYVLNTLMQTFQNK LAHAVKE+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSF VLINLLRPLDPSRWPSPA+ ETFA RNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRIL+SIH+YLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRG +IKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTST P GQ HWGDS ANN +PAT+SA+AQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+PMSTPPP++ + SSP+  PLSPV TNSLNDSK    KPE T+F+LPPSY+ED          +R    EN+L DQRNE+ ISGVTSGTLDAIRERMKSMQLAA  G + D G+RPLMSVNDNLN GLSS         GMENP  GGVLP+DEKALSGLQARMERLKS G+LEPL
Sbjct:   15 PWEDRLLHKNWKVRNEANIDLASLCVSIFDPKDSRLREFAPLFRKTVADSNAPVQEKALDALIAFLRAADADAGRYAKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDAMEKAIKNKVSKAVVPAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILLEKMRDTMKKELEAELVNVTGTAKPSRKIRSEQDKEPEPEGVSEVAGPGQSEEVAPDAPQEIDEYDLMDPVDILSPLEKSGFWDGVKATKWSERKEAVAELTKLASTKRIAPGDFSEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRSHFSGSSRFLLPVLLEKLKEKKPTLTESLTQTLQAMHKAGCSNLADIFAVEYVKTAVKNKVPLVRSLTLNWVTFCIETSNKAVILKVHKDYVPICMESLNDGTPDVRDSAFSVLAAVAKMVGMRPLERSLEKLDDVRRKKLSEMIAGSGDGVAAVATSGTVQT-ARGSMSSVETSESSFVKKSAASMLSGKRPAPAAPANKKAAPTKSGASKKVDGAGRPETSRALEPPEDVEPAEMSLEEIETRLGSLIQADTISQLKSAVWKERLEAISSLKEQVEGLQNCNQSVEILIRLLCAIPGWNEKNVQVQQQFIEVITYLASTASKFPKKCVVLCLLGISERVADIKTRAYAMKCLTTFTEAVGPGFVFDRLYKIMKEHKNPKVLSEGILWMVLAIDDFGVSHLKLKDLIDFCKDTGLQSSVAASRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDAEYEKNPFEGASAIPKKTVRTSESMTCVSGGGLDSLPREDISGKVTPTLIKSLESPDWKVRLESIEAVNKILEEANKRIQPNGTGELFGALRGRLYDSNKNLIMTALTTIGGVASAMGPAVEKSSKGVLSDILKCLGDNKKHMRECALNTLDSWVAAVHLDKMIPYITAALFESKLGAEGRKDLFDWLSKQLSGLSEFPDAIHLLKPAGSAMTDKSADVRKAAEACISEILRVCGQEMIERNLKDIHGPALALVLERVRPASVYQESFESTKTISMGPSSKTSSKVGKAASNGISKHSNRSISSRVIPTKGSKPEPAMSIQDRAVQSQALLNVKDSNKEDRERMVVRRFKFEEPRMEQIQDLEGDMMKYLREDLNRRLLSLDFKKQVDGLEMLQKALPSIGNEIIEVLDILLKWFVLQFCKSNTTCLLKVLEFLPALFDLLRDEAYTLSESEAAIFLPCLIEKLGHNIEKVREKMRELAKQILHAYSATKSFPYILEGLRSKNNRTRIECADLVGFLIDQHGAEISGQLKSLQIVASLTAERDGEIRKAALNALATGYKILGEDIWRYLGKLTDAQKSMIDDRFKWKVREMEKRKEGRPGDARAALRRSVRENGSDIAEQSGEVSQSVSGPILARKNFGTQELQVERHIMPRALTSASGPTDWNEALDIISFSSPEQSVEGMKVVCHELAQATSDEEGSVMDELVKDADRLVSCLANKVARTFDFSLTGASSRSCKYVLNTLMQTFQNKTLAHAVKESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFDVLINLLRPLDPSRWPSPASTETFAIRNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILRSIHIYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGGSIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTAPVGQNHWGDSAANNSSPATHSAEAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPMSTPPPSAPNVSSPDLQPLSPVHTNSLNDSKPLHAKPEATNFHLPPSYSED------GAILSRGFVSENSLGDQRNEKLISGVTSGTLDAIRERMKSMQLAATAG-LPDSGSRPLMSVNDNLNNGLSSLILHAPDSAGMENPVLGGVLPLDEKALSGLQARMERLKS-GSLEPL 2025          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A067GFS8_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000146mg PE=4 SV=1)

HSP 1 Score: 3196.76 bits (8287), Expect = 0.000e+0
Identity = 1684/2018 (83.45%), Postives = 1823/2018 (90.34%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR-LSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLAALCDSITDPKD+R+REL P FKKTVADSNAPVQ+KALDALIA+LKAADADAGRY KEVCDAI AKCLTGRPKTVEKAQA FMLWVELEAV+ FLD MEKAIKNKVAKAVVPAIDVMFQALSEFGAK++PPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVK+ILFEKMRDTMKKELE ELVNV+G A+P+RKIR+EQD+E   E +SE  GPGP+EES AD P EIDEYELVDPVDILTPLEKSGFW+GVKA KWSERK+AVAELTKLASTK+IAPGDFTEVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPT+ ESLTQTLQ MHKAGCLNL D+VEDVKT+ KNKVPLVRSLTLNWVTFCIETS+KA VLKVHKDYVPICMECLNDGTP+VRDAAFS L A+AKSVGMRPLERS+EKLDDVR+ KLSEMIAGSG  V   TSSA V+ SGG   S        FV+KSAASMLSGKRP  AAPA+KKG   K   S K DG+G+ ET+K +E+PED+EP+EMSLEEIESR+GSLI AD + QLKSAVWKERLEAI SL++QVE +Q+LD+SVEILV L+C +PGW+EKNVQVQQQVIEVI YLA +A KFPKKCVVLCLLGISERVAD+KTRAHAMKCLT FSEAVGPGF+FERLYKIMK+HKNPKVLSEG+LWMVSA+EDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEGT   PKKTVR     SS+S+GG DGLPREDIS K TPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQP GTGELFG LRGRLYDSNKNLVMATL T+G VASAMGP VEK+SKG+LSDILKCL DNKKHMRE TL+ LDAW AAVH DKMVPY+T+ALTD+KLGAEGRKDLFDW S+QL+GLS FPDA HLLKPA+ AM DKS+DVRKAA+ C+ EILR  GQE IEKNL+DIQGPALALILER+K  G+ Q         S+G  SK+++KV K+ SNGV+KHGNR ++SR IP KG +P++++ VQ  +VQ QALLNVKDSNKE+RERM VRR KFE+PRIEQIQ+LENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSI K+IIEVLDILLRWFVLQ CKSNTTCLLKVLEFLPELFD+L+ E YSLTE+EAA+FLPCL EK GHNIEKVREKMRELTKQIV  YSATK   YIL+GLRSKNNRTRIECVDLVGF IDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILG+DIWRYVGKLTDAQKSMLDDRFKWKVREMEK+ EG+PGEARAALRRSVRENG D+AEQS +V Q++S     R+NY   +L++ER + PR L  VSGP++WNEALDIISFGSPEQSVEGMKVVCHEL QATNDPEGS+MDEL+KDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLA+AV+E+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPA+NE+FAARNQ+FSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTSTGP GQTHWGDS ANNP  ATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPM+TPPPA+L  SSPEF PLSPV TNS+ND+K  + K EPT+FNLPPSYTEDNR  G A+  ++V  PEN L+DQRNERF   VTSGTLDAIRERMKSMQLAAA GN  D G RPL+++NDN+N GLSSQ+R+ D    +ENPAQG VLPMDEKALSGLQARMERLKS G +EPL
Sbjct:   15 PWEDRLLHKNWKVRNEANIDLAALCDSITDPKDNRIRELGPLFKKTVADSNAPVQDKALDALIAYLKAADADAGRYAKEVCDAIAAKCLTGRPKTVEKAQAVFMLWVELEAVDVFLDVMEKAIKNKVAKAVVPAIDVMFQALSEFGAKIIPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKTILFEKMRDTMKKELEVELVNVSGTARPTRKIRAEQDKELGQELISEDVGPGPSEESTADVPPEIDEYELVDPVDILTPLEKSGFWEGVKATKWSERKDAVAELTKLASTKRIAPGDFTEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTVAESLTQTLQAMHKAGCLNLVDVVEDVKTSVKNKVPLVRSLTLNWVTFCIETSSKAAVLKVHKDYVPICMECLNDGTPEVRDAAFSVLAAIAKSVGMRPLERSIEKLDDVRRNKLSEMIAGSGGDVATGTSSARVQTSGGSVPSVEASESS-FVRKSAASMLSGKRPVSAAPASKKGGPVKP--SAKKDGSGKQETSKLTEAPEDVEPSEMSLEEIESRLGSLIPADTVGQLKSAVWKERLEAISSLRQQVEAVQNLDQSVEILVRLVCMLPGWSEKNVQVQQQVIEVINYLAATATKFPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSEAVGPGFIFERLYKIMKDHKNPKVLSEGILWMVSAVEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDAEYEKNPFEGT-VVPKKTVRASESTSSVSSGGSDGLPREDISGKFTPTLVKSLESPDWKVRLESIEAVNKILEEANKRIQPAGTGELFGGLRGRLYDSNKNLVMATLITLGAVASAMGPAVEKSSKGVLSDILKCLGDNKKHMRECTLTVLDAWLAAVHLDKMVPYVTTALTDAKLGAEGRKDLFDWLSKQLTGLSGFPDAAHLLKPASIAMTDKSSDVRKAAEACIVEILRAGGQETIEKNLKDIQGPALALILERIKLNGASQV--------SMGPTSKSSSKVPKSASNGVSKHGNRAISSRVIPTKGARPESIMSVQDFAVQSQALLNVKDSNKEDRERMVVRRFKFEDPRIEQIQELENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIRKDIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPELFDTLRDEGYSLTESEAAVFLPCLVEKSGHNIEKVREKMRELTKQIVNFYSATKTLPYILEGLRSKNNRTRIECVDLVGFLIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGEDIWRYVGKLTDAQKSMLDDRFKWKVREMEKKKEGKPGEARAALRRSVRENGSDIAEQSGDVSQSVSGPTLMRRNYGHSELHVERSIMPRALASVSGPTDWNEALDIISFGSPEQSVEGMKVVCHELAQATNDPEGSVMDELVKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAYAVQESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPASNESFAARNQRFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGGQTHWGDSAANNPTSATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVHTNSMNDAKSMNVKSEPTNFNLPPSYTEDNR-IGGAI-ASKVLPPENPLSDQRNERFGVAVTSGTLDAIRERMKSMQLAAAAGN-PDPGNRPLINMNDNVNNGLSSQSRSSD-RASVENPAQGSVLPMDEKALSGLQARMERLKS-GTIEPL 2015          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A067GD46_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000146mg PE=4 SV=1)

HSP 1 Score: 3196.37 bits (8286), Expect = 0.000e+0
Identity = 1685/2018 (83.50%), Postives = 1824/2018 (90.39%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR-LSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLAALCDSITDPKD+R+REL P FKKTVADSNAPVQ+KALDALIA+LKAADADAGRY KEVCDAI AKCLTGRPKTVEKAQA FMLWVELEAV+ FLD MEKAIKNKVAKAVVPAIDVMFQALSEFGAK++PPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVK+ILFEKMRDTMKKELE ELVNV+G A+P+RKIR+EQD+E   E +SE  GPGP+EES AD P EIDEYELVDPVDILTPLEKSGFW+GVKA KWSERK+AVAELTKLASTK+IAPGDFTEVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPT+ ESLTQTLQ MHKAGCLNL D+VEDVKT+ KNKVPLVRSLTLNWVTFCIETS+KA VLKVHKDYVPICMECLNDGTP+VRDAAFS L A+AKSVGMRPLERS+EKLDDVR+ KLSEMIAGSG  V   TSSA V+ SGG   S        FV+KSAASMLSGKRP  AAPA+KKG   K   S K DG+G+ ET+K +E+PED+EP+EMSLEEIESR+GSLI AD + QLKSAVWKERLEAI SL++QVE +Q+LD+SVEILV L+C +PGW+EKNVQVQQQVIEVI YLA +A KFPKKCVVLCLLGISERVAD+KTRAHAMKCLT FSEAVGPGF+FERLYKIMK+HKNPKVLSEG+LWMVSA+EDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEGT   PKKTVR     SS+S+GG DGLPREDIS K TPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQP GTGELFG LRGRLYDSNKNLVMATL T+G VASAMGP VEK+SKG+LSDILKCL DNKKHMRE TL+ LDAW AAVH DKMVPY+T+ALTD+KLGAEGRKDLFDW S+QL+GLS FPDA HLLKPA+ AM DKS+DVRKAA+ C+ EILR  GQE IEKNL+DIQGPALALILER+K  G+ Q         S+G  SK+++KV K+ SNGV+KHGNR ++SR IP KG +P++++ VQ  +VQ QALLNVKDSNKE+RERM VRR KFE+PRIEQIQ+LENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSI K+IIEVLDILLRWFVLQ CKSNTTCLLKVLEFLPELFD+L+ E YSLTE+EAA+FLPCL EK GHNIEKVREKMRELTKQIV  YSATK   YIL+GLRSKNNRTRIECVDLVGF IDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILG+DIWRYVGKLTDAQKSMLDDRFKWKVREMEK+ EG+PGEARAALRRSVRENG D+AEQS +V Q++S     R+NY   +L++ER + PR L  VSGP++WNEALDIISFGSPEQSVEGMKVVCHEL QATNDPEGS+MDEL+KDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLA+AV+E+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPA+NE+FAARNQ+FSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTSTGP GQTHWGDS ANNP  ATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPM+TPPPA+L  SSPEF PLSPV TNS+ND+K  + K EPT+FNLPPSYTEDNR  G A+  ++V  PEN L+DQRNERF  GVTSGTLDAIRERMKSMQLAAA GN  D G RPL+++NDN+N GLSSQ+R+ D    +ENPAQG VLPMDEKALSGLQARMERLKS G +EPL
Sbjct:   15 PWEDRLLHKNWKVRNEANIDLAALCDSITDPKDNRIRELGPLFKKTVADSNAPVQDKALDALIAYLKAADADAGRYAKEVCDAIAAKCLTGRPKTVEKAQAVFMLWVELEAVDVFLDVMEKAIKNKVAKAVVPAIDVMFQALSEFGAKIIPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKTILFEKMRDTMKKELEVELVNVSGTARPTRKIRAEQDKELGQELISEDVGPGPSEESTADVPPEIDEYELVDPVDILTPLEKSGFWEGVKATKWSERKDAVAELTKLASTKRIAPGDFTEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTVAESLTQTLQAMHKAGCLNLVDVVEDVKTSVKNKVPLVRSLTLNWVTFCIETSSKAAVLKVHKDYVPICMECLNDGTPEVRDAAFSVLAAIAKSVGMRPLERSIEKLDDVRRNKLSEMIAGSGGDVATGTSSARVQTSGGSVPSVEASESS-FVRKSAASMLSGKRPVSAAPASKKGGPVKP--SAKKDGSGKQETSKLTEAPEDVEPSEMSLEEIESRLGSLIPADTVGQLKSAVWKERLEAISSLRQQVEAVQNLDQSVEILVRLVCMLPGWSEKNVQVQQQVIEVINYLAATATKFPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSEAVGPGFIFERLYKIMKDHKNPKVLSEGILWMVSAVEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDAEYEKNPFEGT-VVPKKTVRASESTSSVSSGGSDGLPREDISGKFTPTLVKSLESPDWKVRLESIEAVNKILEEANKRIQPAGTGELFGGLRGRLYDSNKNLVMATLITLGAVASAMGPAVEKSSKGVLSDILKCLGDNKKHMRECTLTVLDAWLAAVHLDKMVPYVTTALTDAKLGAEGRKDLFDWLSKQLTGLSGFPDAAHLLKPASIAMTDKSSDVRKAAEACIVEILRAGGQETIEKNLKDIQGPALALILERIKLNGASQV--------SMGPTSKSSSKVPKSASNGVSKHGNRAISSRVIPTKGARPESIMSVQDFAVQSQALLNVKDSNKEDRERMVVRRFKFEDPRIEQIQELENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIRKDIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPELFDTLRDEGYSLTESEAAVFLPCLVEKSGHNIEKVREKMRELTKQIVNFYSATKTLPYILEGLRSKNNRTRIECVDLVGFLIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGEDIWRYVGKLTDAQKSMLDDRFKWKVREMEKKKEGKPGEARAALRRSVRENGSDIAEQSGDVSQSVSGPTLMRRNYGHSELHVERSIMPRALASVSGPTDWNEALDIISFGSPEQSVEGMKVVCHELAQATNDPEGSVMDELVKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAYAVQESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPASNESFAARNQRFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGGQTHWGDSAANNPTSATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVHTNSMNDAKSMNVKSEPTNFNLPPSYTEDNR-IGGAI-ASKVLPPENPLSDQRNERF--GVTSGTLDAIRERMKSMQLAAAAGN-PDPGNRPLINMNDNVNNGLSSQSRSSD-RASVENPAQGSVLPMDEKALSGLQARMERLKS-GTIEPL 2013          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Match: A0A067GQB7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000146mg PE=4 SV=1)

HSP 1 Score: 3176.34 bits (8234), Expect = 0.000e+0
Identity = 1685/2057 (81.92%), Postives = 1824/2057 (88.67%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELA---------------------------------------PFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVR-LSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERERM-VRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTIS-----RKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PWEDRL HKNWKVRNEANIDLAALCDSITDPKD+R+REL                                        P FKKTVADSNAPVQ+KALDALIA+LKAADADAGRY KEVCDAI AKCLTGRPKTVEKAQA FMLWVELEAV+ FLD MEKAIKNKVAKAVVPAIDVMFQALSEFGAK++PPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVK+ILFEKMRDTMKKELE ELVNV+G A+P+RKIR+EQD+E   E +SE  GPGP+EES AD P EIDEYELVDPVDILTPLEKSGFW+GVKA KWSERK+AVAELTKLASTK+IAPGDFTEVCRTLKKL+TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPT+ ESLTQTLQ MHKAGCLNL D+VEDVKT+ KNKVPLVRSLTLNWVTFCIETS+KA VLKVHKDYVPICMECLNDGTP+VRDAAFS L A+AKSVGMRPLERS+EKLDDVR+ KLSEMIAGSG  V   TSSA V+ SGG   S        FV+KSAASMLSGKRP  AAPA+KKG   K   S K DG+G+ ET+K +E+PED+EP+EMSLEEIESR+GSLI AD + QLKSAVWKERLEAI SL++QVE +Q+LD+SVEILV L+C +PGW+EKNVQVQQQVIEVI YLA +A KFPKKCVVLCLLGISERVAD+KTRAHAMKCLT FSEAVGPGF+FERLYKIMK+HKNPKVLSEG+LWMVSA+EDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEGT   PKKTVR     SS+S+GG DGLPREDIS K TPTL+KSLESPDWKVRLESIEAVNKILEEANKRIQP GTGELFG LRGRLYDSNKNLVMATL T+G VASAMGP VEK+SKG+LSDILKCL DNKKHMRE TL+ LDAW AAVH DKMVPY+T+ALTD+KLGAEGRKDLFDW S+QL+GLS FPDA HLLKPA+ AM DKS+DVRKAA+ C+ EILR  GQE IEKNL+DIQGPALALILER+K  G+ Q         S+G  SK+++KV K+ SNGV+KHGNR ++SR IP KG +P++++ VQ  +VQ QALLNVKDSNKE+RERM VRR KFE+PRIEQIQ+LENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSI K+IIEVLDILLRWFVLQ CKSNTTCLLKVLEFLPELFD+L+ E YSLTE+EAA+FLPCL EK GHNIEKVREKMRELTKQIV  YSATK   YIL+GLRSKNNRTRIECVDLVGF IDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILG+DIWRYVGKLTDAQKSMLDDRFKWKVREMEK+ EG+PGEARAALRRSVRENG D+AEQS +V Q++S     R+NY   +L++ER + PR L  VSGP++WNEALDIISFGSPEQSVEGMKVVCHEL QATNDPEGS+MDEL+KDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLA+AV+E+TLD+LITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPA+NE+FAARNQ+FSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLS+VPIDMKPQPIILAYIDLNLETLAAARMLTSTGP GQTHWGDS ANNP  ATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPM+TPPPA+L  SSPEF PLSPV TNS+ND+K  + K EPT+FNLPPSYTEDNR  G A+  ++V  PEN L+DQRNERF  GVTSGTLDAIRERMKSMQLAAA GN  D G RPL+++NDN+N GLSSQ+R+ D    +ENPAQG VLPMDEKALSGLQARMERLKS G +EPL
Sbjct:   15 PWEDRLLHKNWKVRNEANIDLAALCDSITDPKDNRIRELGQFSFIVSDLTFVWIRIEHCGCEMMRCRFTSIYSFVLMLGPLFKKTVADSNAPVQDKALDALIAYLKAADADAGRYAKEVCDAIAAKCLTGRPKTVEKAQAVFMLWVELEAVDVFLDVMEKAIKNKVAKAVVPAIDVMFQALSEFGAKIIPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKTILFEKMRDTMKKELEVELVNVSGTARPTRKIRAEQDKELGQELISEDVGPGPSEESTADVPPEIDEYELVDPVDILTPLEKSGFWEGVKATKWSERKDAVAELTKLASTKRIAPGDFTEVCRTLKKLITDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFLLPVLLEKLKEKKPTVAESLTQTLQAMHKAGCLNLVDVVEDVKTSVKNKVPLVRSLTLNWVTFCIETSSKAAVLKVHKDYVPICMECLNDGTPEVRDAAFSVLAAIAKSVGMRPLERSIEKLDDVRRNKLSEMIAGSGGDVATGTSSARVQTSGGSVPSVEASESS-FVRKSAASMLSGKRPVSAAPASKKGGPVKP--SAKKDGSGKQETSKLTEAPEDVEPSEMSLEEIESRLGSLIPADTVGQLKSAVWKERLEAISSLRQQVEAVQNLDQSVEILVRLVCMLPGWSEKNVQVQQQVIEVINYLAATATKFPKKCVVLCLLGISERVADIKTRAHAMKCLTTFSEAVGPGFIFERLYKIMKDHKNPKVLSEGILWMVSAVEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKLLGALHKFVGPDIKGFLADVKPALLSALDAEYEKNPFEGT-VVPKKTVRASESTSSVSSGGSDGLPREDISGKFTPTLVKSLESPDWKVRLESIEAVNKILEEANKRIQPAGTGELFGGLRGRLYDSNKNLVMATLITLGAVASAMGPAVEKSSKGVLSDILKCLGDNKKHMRECTLTVLDAWLAAVHLDKMVPYVTTALTDAKLGAEGRKDLFDWLSKQLTGLSGFPDAAHLLKPASIAMTDKSSDVRKAAEACIVEILRAGGQETIEKNLKDIQGPALALILERIKLNGASQV--------SMGPTSKSSSKVPKSASNGVSKHGNRAISSRVIPTKGARPESIMSVQDFAVQSQALLNVKDSNKEDRERMVVRRFKFEDPRIEQIQELENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIRKDIIEVLDILLRWFVLQFCKSNTTCLLKVLEFLPELFDTLRDEGYSLTESEAAVFLPCLVEKSGHNIEKVREKMRELTKQIVNFYSATKTLPYILEGLRSKNNRTRIECVDLVGFLIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGEDIWRYVGKLTDAQKSMLDDRFKWKVREMEKKKEGKPGEARAALRRSVRENGSDIAEQSGDVSQSVSGPTLMRRNYGHSELHVERSIMPRALASVSGPTDWNEALDIISFGSPEQSVEGMKVVCHELAQATNDPEGSVMDELVKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAYAVQESTLDSLITELLLWLLDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPASNESFAARNQRFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSMVPIDMKPQPIILAYIDLNLETLAAARMLTSTGPGGQTHWGDSAANNPTSATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVHTNSMNDAKSMNVKSEPTNFNLPPSYTEDNR-IGGAI-ASKVLPPENPLSDQRNERF--GVTSGTLDAIRERMKSMQLAAAAGN-PDPGNRPLINMNDNVNNGLSSQSRSSD-RASVENPAQGSVLPMDEKALSGLQARMERLKS-GTIEPL 2052          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: MOR1_ARATH (Protein MOR1 OS=Arabidopsis thaliana GN=MOR1 PE=1 SV=1)

HSP 1 Score: 2872.8 bits (7446), Expect = 0.000e+0
Identity = 1523/2023 (75.28%), Postives = 1713/2023 (84.68%), Query Frame = -1
Query:  372 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERER-MVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCEVPQTI-----SRKNYVQPDLNMERHLTPRMLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALA--DQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSS------QTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALE 6395
            PWEDRL HKNWKVRNEAN+DLA++ DSITDPKD RLR+    F+KTVADSNAPVQEKALDALIAFL+AAD+DAGRY KEVCDAI  KCLTGR  TV+KAQAAF+LWVELEAV+ FLD+MEKAIKNKVAKAVVPA+DVMFQALSEFG+KV+PPKRILKMLPELFDHQDQNVRAS+KG+TLELCRWIGKDPVKSILFEKMRDTMKKELEAEL NVT  AKP+RKIRSEQD+EPE EA S+  G GP+EE++AD PQEIDEY+L+DPVDILTPLEKSGFWDGVKA KWSERKEAVAELTKLASTKKIAPGDF+E+CRTLKKL+TDVN+AVAVEAIQAIGNLA GLRTHFS SSRF+LPVLLEKLKEKK ++T+ LTQTLQ M+KAGCLNL D++EDVKTA KNKVPLVRS TL W+TFC+ETSNKA++LK HK+YVP+CMECLNDGTPDVRDAAFSAL A+AKSVGMRPLERSLEKLDDVRKKKLSEMIAGSG      TSS  V++    G ++T  S+ SFV+KSAASMLSGKRPAP+A A+KK  + K G  KK     R E +KS E PED+EPAEM LEEIE+R+GSL++ + +SQLKS+VWKERLEA  +LKE++EGLQ+LD+SVEILV LLCA+PGWNEKNVQVQQQVIE+ITY++++AAKFPKKCVVLC+ G SERVAD+KTRA AMKCLTAF EAVGPGFVFERL+KIMKEHKNPKVLSEGLLWMVSA++DFGVS LKLKDLIDFCKD GLQSS AATRNATIK+LGALHKFVGPDIKGFL DVKPALLSALD EY+KNPFEGT+ APK+ V+ S  +S S+GGLD LPREDIS KITP LLK  ESPDWK+RLESIEAVNKILEEANKRIQPTGTGELFG LRGRL DSNKNLVM TLTT+G VA+AMGP VEKASKGILSD+LKCL DNKKHMRE TL+ LD W  AVH DKM+PYI  ALTD K+GAEGRKDLFDW ++QL+GLS+F DA+HLLKPA+TAM DKSADVRKAA+GC++EILRVSGQE IEKNL+DIQGPALAL+LE+V+P G  QE  E SK  + G VSK  TK++K+TSNG  K GNR   SRA+P KG     +  V  I++Q QALLN KDSNKE+RER +VRR KFEE R EQIQDLENDMMK+FREDL +RLLS DFKKQVDGLE+LQKALPS+ KEIIEVLD+LLRWFVLQ CKSNTTCLLKVLEFLPELF++L+ E Y +TEAEAAIFLPCLAEKLGHNIEKVREKMREL KQI+Q YS  K Y YIL+GLRSKNNRTRIEC DL+G+ ++  G EI G LK L IVASLTAERDGE+RKAALNT+ATGY+ILG DIW+YVGKLTDAQKSM+DDRFKWK ++MEKR EG+PGEARAALRRSVR++GP+VAEQS ++ QT+      R++Y   +  +ER   PR + GV+GP++WNEALDII FGSPEQSVEGMKVVCHEL QA+NDPE S +DEL+KDAD LVSCLANKVAKTFD SL GASSRSCKYVLNTLMQTFQNK+LAHAVKE TL++LITELLLWLLDERVP M+DGSQLLKALNVLMLKILDNADRTSSFVVLI+LLRPLDPSRWPSPAT E +A RNQKFSDLVVKCLIKLTK+LQSTIY+VDLDR+LQSIHVYLQ+LGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDM+PQPIILAYIDLNLETLAAARMLT+TGP GQTHW DS ANNP+P  NSAD QLKQEL AIFKKIGDKQT TIGLY+LY IT+ YPKVDIF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTP                                 S L  + P P+S  LP      +  S ++++   +  P + L   D R      GV +GTLDAIRERMK+MQLA++     +  ++PLM  NDNL++   S         T+  HP         VLPMDEKALSGLQARMERLK GG+LE
Sbjct:   16 PWEDRLGHKNWKVRNEANVDLASVFDSITDPKDPRLRDFGHLFRKTVADSNAPVQEKALDALIAFLRAADSDAGRYAKEVCDAIALKCLTGRKNTVDKAQAAFLLWVELEAVDVFLDTMEKAIKNKVAKAVVPAVDVMFQALSEFGSKVIPPKRILKMLPELFDHQDQNVRASAKGVTLELCRWIGKDPVKSILFEKMRDTMKKELEAELANVTAGAKPTRKIRSEQDKEPEAEASSDVVGDGPSEEAVADAPQEIDEYDLMDPVDILTPLEKSGFWDGVKATKWSERKEAVAELTKLASTKKIAPGDFSEICRTLKKLITDVNLAVAVEAIQAIGNLACGLRTHFSASSRFMLPVLLEKLKEKKQSVTDPLTQTLQTMYKAGCLNLVDVIEDVKTAVKNKVPLVRSSTLTWLTFCLETSNKALILKAHKEYVPLCMECLNDGTPDVRDAAFSALAAIAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGGGDQAGTSSVTVQS--SVGSTATGNSDASFVRKSAASMLSGKRPAPSAQASKKVGTGKPGGGKKDGSV-RNEGSKSVEPPEDVEPAEMGLEEIENRLGSLVKPETVSQLKSSVWKERLEATLALKEEIEGLQELDKSVEILVRLLCAVPGWNEKNVQVQQQVIEIITYISSTAAKFPKKCVVLCITGTSERVADIKTRASAMKCLTAFCEAVGPGFVFERLFKIMKEHKNPKVLSEGLLWMVSAVDDFGVSLLKLKDLIDFCKDVGLQSSTAATRNATIKLLGALHKFVGPDIKGFLNDVKPALLSALDTEYEKNPFEGTA-APKRVVKTSVSTSTSSGGLDSLPREDISTKITPNLLKGFESPDWKMRLESIEAVNKILEEANKRIQPTGTGELFGGLRGRLLDSNKNLVMQTLTTIGGVAAAMGPAVEKASKGILSDVLKCLGDNKKHMRECTLAALDLWLGAVHLDKMIPYIIIALTDGKMGAEGRKDLFDWLTKQLTGLSDFVDAIHLLKPASTAMTDKSADVRKAAEGCISEILRVSGQEMIEKNLKDIQGPALALVLEKVRP-GFVQEPFESSKAMA-GPVSKGVTKISKSTSNGTLKQGNR---SRAVPTKG--SSQITSVHDIAIQSQALLNTKDSNKEDRERVVVRRIKFEELRPEQIQDLENDMMKFFREDLQKRLLSPDFKKQVDGLEILQKALPSVSKEIIEVLDVLLRWFVLQFCKSNTTCLLKVLEFLPELFNTLRDEEYCMTEAEAAIFLPCLAEKLGHNIEKVREKMRELMKQIIQAYSVGKTYPYILEGLRSKNNRTRIECTDLIGYLLETCGTEIGGLLKYLNIVASLTAERDGELRKAALNTMATGYQILGADIWKYVGKLTDAQKSMIDDRFKWKAKDMEKRREGKPGEARAALRRSVRDSGPEVAEQSGDISQTVPGPLFPRQSYGISEQMLERTPVPRTIAGVNGPTDWNEALDIIMFGSPEQSVEGMKVVCHELAQASNDPEESAIDELVKDADGLVSCLANKVAKTFDVSLMGASSRSCKYVLNTLMQTFQNKKLAHAVKEGTLESLITELLLWLLDERVPRMEDGSQLLKALNVLMLKILDNADRTSSFVVLISLLRPLDPSRWPSPATAEVYAVRNQKFSDLVVKCLIKLTKLLQSTIYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLETLAAARMLTATGPVGQTHWTDSTANNPSPPANSADVQLKQELGAIFKKIGDKQTSTIGLYDLYHITKSYPKVDIFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTP---------------------------------SSLPLSTPPPSSLALP----SPDIPSLSSLDVKPLMNPRSDLYTDDIRASNMNPGVMTGTLDAIRERMKNMQLASS-----EPVSKPLMPTNDNLSMNQQSVPPSQMGQETVHTHP--------VVLPMDEKALSGLQARMERLK-GGSLE 1976          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: MOR1_ORYSJ (Protein MOR1 OS=Oryza sativa subsp. japonica GN=MOR1 PE=2 SV=1)

HSP 1 Score: 2679.05 bits (6943), Expect = 0.000e+0
Identity = 1442/2025 (71.21%), Postives = 1674/2025 (82.67%), Query Frame = -1
Query:  366 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTETAKSSESP--EDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGL-DGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGLSEFPDAVHLLKPAATAMMDKSADVRKAADGCVTEILRVSGQEAIEKNLRDIQGPALALILERVKPYGSFQELVEPSK--GGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERER--MVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQLKSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFKWKVREMEKRGEGRPGEARAALRRSVRENGPDVAEQSCE------VPQTISRKNYVQPDLNMERHLTPR-MLVGVSGPSNWNEALDIISFGSPEQSVEGMKVVCHELTQATNDPEGSLMDELMKDADRLVSCLANKVAKTFDFSLTGASSRSCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLTSTGP-GQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTXXXXXXXXXXXXXXXXXXXXXXXXXPVQTNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGVTSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPHPGMENPAQGGVLPMDEKALSGLQARMERLKSGGALEPL 6395
            PW++RL HKNWKVRN+ANIDLAALCDSITDPKD+RLRE  P FKKTVADSNAPVQEKALDAL+AF +AADADA RY KEVCDAIVAKCLTGRPKTVEKAQAAF+LWVELEA E FL+SMEKA+KNKVAKAVVPAIDVMFQALSEFGAKVVPPK+ILKMLPELFDH DQNVRASSKGLTLELCRWIGK+PVK+ILFEKMRDTMKKELEAEL NV+G AKP+RKIRSEQ++E E E V EAAG   +EE++ + P EIDEY+LVDPVDILTPLEKSGFWDGVKA KWSER++AVAELTKLASTKKIAPGDF E+CRTLKKL+TDVN+AV+VEA QAIGNLA+GLRTHFSG+SR LLPVLLEKLKEKKPT+TE+L+QTLQ MHK+GC+ L D++EDV+ A KNKVPLVRSLTLNWV FCIETSNKA VLK+HK+YVPICMECLNDGTP+VRDA+FS LTA+AK VGM+PLERSLEKLDDVRKKKLS+MI GS S     T +A+   + G G S+ EV + S +++SAASMLSGK+P  A PA KK   AKS  +KK DG  ++   K+S +P  ED+EP+EMSLEEIE ++ S+++++ ISQLKS VWKERLEAI  LK++VE L +LD+S E+LV LLCA+PGW+EKNVQVQQQVIEV TY+A++  +FPK+CVVLCLLGISERVAD+KTR HAMKCLTAF EAVGPGFVFERLYKIMKEHKNPKVLSEG+LWMVSA+EDFG+S+LKLKD IDFCKD GLQSSAAATRNATIK++G LHKFVGPDIKGFL+DVKPALLS LD EY+KNPFEGT++APK+TVR ++  S ++ G  DGLPREDISAKITPTLLK+L SPDWK+RLESI+AV+KI+EEA+KRIQPTGT ELF ALR RLYDSNKNLVMATL+T+G +ASAMGP VEK+SKGIL+D+LKCL DNKKHMRE TL+ LD W AA   DKMVPYIT  L D K G+EGRKDLFDW S+  S +S+  +A+ LLKP+A+++MDKS++VRKAA+  + EIL++ GQ+ + KNL+D+  P LA++ ER+K     +   +  K    S+ L SK  +K  K   N    + ++ V+ R IPA+     TM+  Q  S+Q QAL N+KDSNKEERER  +VR+ KFEEPR EQI +L+ ++ ++FRED+  RL ++DFK+Q+DG+E+LQKALPS  KE+IE+LDILLRWFVL+ C+SNTTCLLKVL+FLPELFD LK ++Y LTEAEAAIFLPCL EK GHNIEKVREKM EL KQ+V +YS  K+  YIL+GLRSKNNRTRIECVD++G+F+DHHG E+SG LK+L  VA+LTAERDGEIRKAALNTLAT YK LGDD+WRYVGKL+DAQ+SMLDDRFKWK REM+KR EGRPG+ARAALRRSVRENG D+AEQS E          ISR+N+   D     H+ PR M     GP++W EALDI++ G PEQSVEGMKV+CHELTQA  DPE S++D+L+K+ADRLVSCLA  V KTF+FSL+GASSRSCKYVLNTLMQTFQ KRLAHAVKE TLDNLITELLLWLLDERVP MDDGSQLLKALNVLMLKILDNA+RTSSFVVLINLLRPLDPSRWPSP   E+ A +NQKFSDLVVKCLIKLTKVLQSTIY+VDLDRILQSIH+YLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRG AIKGHLS+VPID +PQPIILAYIDLNL+TLAAARMLT +G  GQTHWGD+G+NNP P+T+S DAQLKQELAA+FKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRT     +    P  ++         SPV T S+N+ K    + +      P       RG G   N  +         + + +R+ S   SGTLDA+RERMKS+Q AA G N D    RPL S+N N    L   TR LD  P  +N     + PMDE+ALSGLQARMERLKS G++EPL
Sbjct:   16 PWDERLQHKNWKVRNDANIDLAALCDSITDPKDARLREFGPLFKKTVADSNAPVQEKALDALLAFQRAADADASRYAKEVCDAIVAKCLTGRPKTVEKAQAAFLLWVELEAAEVFLESMEKAVKNKVAKAVVPAIDVMFQALSEFGAKVVPPKKILKMLPELFDHPDQNVRASSKGLTLELCRWIGKEPVKAILFEKMRDTMKKELEAELANVSGIAKPTRKIRSEQEKELEEEVVPEAAGTNNSEEAVPEAPMEIDEYDLVDPVDILTPLEKSGFWDGVKATKWSERRDAVAELTKLASTKKIAPGDFHEICRTLKKLITDVNLAVSVEATQAIGNLAKGLRTHFSGNSRVLLPVLLEKLKEKKPTMTEALSQTLQAMHKSGCITLLDVIEDVRVAVKNKVPLVRSLTLNWVAFCIETSNKATVLKLHKEYVPICMECLNDGTPEVRDASFSVLTAIAKMVGMKPLERSLEKLDDVRKKKLSDMI-GSASDTTSGTVAAS---NTGVGTSAREVMDSSSMRRSAASMLSGKKPVQAVPATKKSGPAKSATAKKTDGGPQS---KASAAPVIEDVEPSEMSLEEIEEKLSSVVKSETISQLKSTVWKERLEAISMLKQEVESLTELDKSAELLVRLLCAVPGWSEKNVQVQQQVIEVSTYIASTVNRFPKRCVVLCLLGISERVADIKTRGHAMKCLTAFCEAVGPGFVFERLYKIMKEHKNPKVLSEGILWMVSAVEDFGISNLKLKDTIDFCKDIGLQSSAAATRNATIKLIGVLHKFVGPDIKGFLSDVKPALLSTLDAEYEKNPFEGTASAPKRTVRAADAVSSASSGTSDGLPREDISAKITPTLLKNLGSPDWKLRLESIDAVSKIVEEAHKRIQPTGTVELFTALRARLYDSNKNLVMATLSTIGGLASAMGPAVEKSSKGILADVLKCLGDNKKHMRECTLTALDLWVAAAQLDKMVPYITVTLGDQKTGSEGRKDLFDWLSKHASNMSDPSEALPLLKPSASSLMDKSSEVRKAAESFMNEILKICGQDVVAKNLKDLPSPTLAIVAERLKLSTVHEGFSDSVKMVTTSMSLPSKAGSKNNKHGPNDRGSNVSKAVSQRGIPARS--SVTMISSQD-SIQSQALFNIKDSNKEERERRVLVRKFKFEEPRREQIDELKIELFRHFREDVSLRLWNSDFKRQIDGIELLQKALPSSRKEVIELLDILLRWFVLRFCESNTTCLLKVLDFLPELFDVLKDQSYMLTEAEAAIFLPCLMEKSGHNIEKVREKMGELIKQMVNIYSLPKLLPYILEGLRSKNNRTRIECVDIIGYFMDHHGTEVSGLLKNLPSVAALTAERDGEIRKAALNTLATAYKNLGDDVWRYVGKLSDAQRSMLDDRFKWKAREMDKRREGRPGDARAALRRSVRENGSDIAEQSGEAVSRSMAGSMISRENFGYSD----AHMVPRQMATATPGPADWREALDIVALGLPEQSVEGMKVICHELTQAV-DPESSVLDDLIKEADRLVSCLAVMVPKTFNFSLSGASSRSCKYVLNTLMQTFQIKRLAHAVKEGTLDNLITELLLWLLDERVPLMDDGSQLLKALNVLMLKILDNAERTSSFVVLINLLRPLDPSRWPSPTPPESLAVKNQKFSDLVVKCLIKLTKVLQSTIYEVDLDRILQSIHIYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGTAIKGHLSMVPIDAEPQPIILAYIDLNLQTLAAARMLTPSGTMGQTHWGDAGSNNPNPSTHSTDAQLKQELAAVFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQVEKNAAAGRT--PSSLPLSTPPPIAPIPSPKFAPSPVHTKSINN-KTDCNEDDAGGDTHP------FRGQGEIDNRLQT-------TNLQTDRYQS---SGTLDALRERMKSIQAAAVGANFDGVQARPLPSMNGN---TLHGGTR-LDADPQTQNI----IPPMDERALSGLQARMERLKS-GSMEPL 1997          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: CKAP5_MOUSE (Cytoskeleton-associated protein 5 OS=Mus musculus GN=Ckap5 PE=2 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 1.571e-149
Identity = 440/1432 (30.73%), Postives = 717/1432 (50.07%), Query Frame = -1
Query: 2250 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTG-RPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNV-TGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLV-TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLK-VHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVG---MRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKR--XXXXXXANKKGTSAKSGNSKKVDGAGR--TETAKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTS-TAPKKTVRLSEPSSLSAGG------------LDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEG---RKDLFDWSSRQLSGLSEFPDAVHLLKPA-ATAMMDKSADVRKAADGCVTEILRVSGQEAIEK---NLRDIQGPALALILERV------KPYGSFQELVEPSKGGSIGLVSKTNTKVAKATSNGV------TKHGNRTVTSRAIPAKGLKPDTMLPVQGISVQPQALLNVKDSNKEERER-----MVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQL--KSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFK 6395
            P + +  HK WK R     +   +   I D K     +     KK V DSNA VQ K L+A + +++ A   AG+   EV   +V+K     + K  E      +++VE+E  E+  + + K + NK  K +V  I+ + +ALSEFG+K++  K I+K+LP+LF+ +D+ VR  +K   +E+ RW  +D VK  L + +     KELE E V + TGA KPSR +RS+Q+ E + E    A G         D   ++D YEL+D V+IL+ L K  F+D ++A KW ERKEA+  +  L    K+  GD+ ++ + LKK+V  D N+ +   A + +  LA GLR  F   +  ++P +LEK KEKKP + ++L + +  +     L   +I EDV     NK P ++  T  ++         + + K + K +    ++ +ND  P+VRDAAF AL    K VG   + P    ++KL   R K+ SE +      V G  S  A +      +     + G+   K     +SG +  P    P  K G  +K G +    G+    T+  K  E+ E +EP E+S+E  E +  +++    I  L S+ WKERL  +   ++ VE ++  +   + LV +L   PGW E N QV Q  + ++  +A     F K    + L G+ +++ D+K   +A + +TA +EA    +  E++  +    KNPK  SE L W+ +AI++FG S L +K  I   K T L ++  A R + I +LG ++ +VGP ++    D KPALLS +D E+QK   +G S  AP + +     S+   G             +D LPR +IS KIT  L+  +   +WK+R E ++ V  I+ EA K IQP   GEL  AL+GRL DSNK LV  TL  +  +A AMG  + +  K +   ++  L D+K ++R + L+T++AW        M  ++       +L  E    R++L  W + +L  L   P  + L  P   + + D++ DVRK A   +   +   G E + K    L+      +  +LE+       KP    + + +P  G +          V  + S+ +       K     V+S+A   +G K  +   ++    +   +  V  + KE+R R      V +  F  PR E I+ L+  M     + L   +  +DF+     L ++   L S    +I  LD++L+W  L+   +NT+ L+K LE+L  LF  L  E Y LTE EA+ F+P L  K+G   + +R+ +R +  ++  VY A+K++ +I++G +SKN++ R EC++ +G  I+ +G  +      K+L+ +A    +RD  +R AALNT+ T Y + GD +++ +G L++   SML++R K
Sbjct:   11 PVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHV-AGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRW-NRDAVKHTL-QNINSVQLKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQVDAYELLDAVEILSKLPKD-FYDKIEAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQ--NISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDRIKECSEKV----ELVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKD-VSGPKPGPLKKTPTAKAGGPSKKGKTTAPGGSASAGTKNKKGLETKEIVEP-ELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMERTEMPCQALVKMLAKKPGWKETNFQVMQMKLHIVALIAQK-GNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVMSMAFSQKNPKNQSETLNWLSNAIKEFGFSELNVKAFISNVK-TALAATNPAVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQK--MQGQSPPAPTRGIAKHSTSATDEGEDGEEPGEGGNDVVDLLPRIEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINEA-KFIQP-NIGELPTALKGRLNDSNKILVQQTLNILQQLAVAMGANIRQHVKNLGIPVITVLGDSKNNVRAAALATVNAWAEQTG---MKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLKDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPAPVEDSVSSTIEAKPDLKKAKAPGVSSKAKSVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLKVLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKDGVISCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLILKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIK 1421          

HSP 2 Score: 120.939 bits (302), Expect = 9.330e-26
Identity = 94/302 (31.13%), Postives = 165/302 (54.64%), Query Frame = -1
Query:  927 SCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLT----STGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQME 1820
            SC  ++  ++  FQ + LA       L +L+  L+  +LD R+  +++G Q+++++N+L++K+L+ +D+T+    L+ LL+    +   SP           KFS+LV+KCL ++ ++L  TI  ++LDRIL  IH++++    E++++     + P+R +KT+LH L KL+G  I  HL++  ID K +  + A++          RM+      TG       + GA+       S+ A++   LA IFKKIG K+    GL ELY   + Y   DI   L+N+S+ F++Y+  GL  +E
Sbjct: 1615 SC--IIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSP-----------KFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQ--CKSEFPIRTLKTLLHTLCKLKGPKILDHLTM--IDNKNESELEAHL---------CRMMKHSMDQTGSKSDKETEKGASRID--EKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIE 1888          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: CKAP5_HUMAN (Cytoskeleton-associated protein 5 OS=Homo sapiens GN=CKAP5 PE=1 SV=3)

HSP 1 Score: 517.694 bits (1332), Expect = 5.424e-149
Identity = 442/1449 (30.50%), Postives = 724/1449 (49.97%), Query Frame = -1
Query: 2250 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCLTG-RPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNV-TGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLV-TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLK-VHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLS------EMIAGSGSS----------VPGATSSAAVKNXXXXXXXXXXXXXXSFVKKSAASMLSGKRXXXXXXANKKGTSAKSGNSKKVDGAGRTET--AKSSESPEDIEPAEMSLEEIESRIGSLIQADVISQLKSAVWKERLEAIFSLKEQVEGLQDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPKKCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHLKLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTS-TAPKKTVRLS------------EPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAMGPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAWNAAVHFDKMVPYITSALTDSKLGAEG---RKDLFDWSSRQLSGLSEFPDAVHLLKPA-ATAMMDKSADVRKAADGCVTEILRVSGQEAIEK---NLRDIQGPALALILERV----------------KPYGS-----FQELVEPSKGGSIGLVSKTNTKVAKATSNGVTKHGNRTVTSRAIPAK-GLKPDTMLPVQGISVQPQALLNVKDSN-KEERERMVRRSKFEEPRIEQIQDLENDMMKYFREDLHRRLLSTDFKKQVDGLEMLQKALPSIGKEIIEVLDILLRWFVLQLCKSNTTCLLKVLEFLPELFDSLKGEAYSLTEAEAAIFLPCLAEKLGHNIEKVREKMRELTKQIVQVYSATKIYTYILDGLRSKNNRTRIECVDLVGFFIDHHGAEISGQL--KSLQIVASLTAERDGEIRKAALNTLATGYKILGDDIWRYVGKLTDAQKSMLDDRFK 6395
            P + +  HK WK R     +   +   I D K     +     KK V DSNA VQ K L+A + +++ A   AG+   EV   +V+K     + K  E      ++++E+E  EA  + + K + NK  K +V  I+ + +ALSEFG+K++  K I+K+LP+LF+ +++ VR  +K + +E+ RWI +D ++  L + +     KELE E V + T A +P+R +RS+Q+ E + E    A G         D   +ID YEL++ V+IL+ L K  F+D ++A KW ERKEA+  +  L    K+  GD+ ++ + LKK+V  D N+ +   A + +  LA GLR  F   +  ++P +LEK KEKKP + ++L + +  +     L   +I EDV     NK P ++  T  ++         + + K + K +    ++ +ND  P+VRDAAF AL    K VG + +   L  +D ++  K+       E+I G  +           +PG T+++           S        +KK+ A+   G          KKG  A  G      GAG T T   K  E+ E +EP E+S+E  E +  +++    I  L S+ WKERL  +   ++ VE +   +   + LV +L   PGW E N QV Q  + ++  +A     F K    + L G+ +++ D+K   +A + +TA +EA    +  E++  +    KNPK  SE L W+ +AI++FG S L +K  I   K T L ++  A R A I +LG ++ +VGP ++ F  D KPALLS +D E++K   +G S  AP + +               EP   S   +D LPR +IS KIT  L+  +   +WK+R E ++ V  I+ +A K IQP   GEL  AL+GRL DSNK LV  TL  +  +A AMGP +++  K +   I+  L D+K ++R + L+T++AW        M  ++       +L  E    R++L  W + +L  L   P  + L  P   + + D++ DVRK A   +   +   G E + K    L+      +  +LE+                 KP G      FQ    P++   I   ++      KA + G++    ++   + +P+K  LK D         V P    N K+   K+E+   V +  F  PR E I+ L+  M     + L   +  +DF+     L ++   L S  + +I  LD++L+W  L+   +NT+ L+K LE+L  LF  L  E Y LTE EA+ F+P L  K+G   + +R+ +R +  ++  VY A+K++ +I++G +SKN++ R EC++ +G  ++ +G  +      K+L+ +A    +RD  +R AALNT+ T Y + GD +++ +G L++   SML++R K
Sbjct:   11 PVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHV-AGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWI-RDALRPPL-QNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKD-FYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQ--NISEDVLAVMDNKNPTIKQQTSLFIARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGP--LKKAPAAKAGG--------PPKKGKPAAPG------GAGNTGTKNKKGLETKEIVEP-ELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQK-GNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVK-TALAATNPAVRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEK--MQGQSPPAPTRGISKHSTSGTDEGEDGDEPDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDA-KFIQP-NIGELPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTG---MKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAE-DCISSSTEPKPDPKKAKAPGLSSKA-KSAQGKKMPSKTSLKEDEDKSGPIFIVVP----NGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIK 1421          

HSP 2 Score: 121.324 bits (303), Expect = 7.884e-26
Identity = 94/302 (31.13%), Postives = 165/302 (54.64%), Query Frame = -1
Query:  927 SCKYVLNTLMQTFQNKRLAHAVKXXXXXXXXXXXXXXXXDERVPHMDDGSQLLKALNVLMLKILDNADRTSSFVVLINLLRPLDPSRWPSPATNETFAARNQKFSDLVVKCLIKLTKVLQSTIYDVDLDRILQSIHVYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMKPQPIILAYIDLNLETLAAARMLT----STGPGQTHWGDSGANNPAPATNSADAQLKQELAAIFKKIGDKQTCTIGLYELYRITQLYPKVDIFAQLQNASEAFRTYIRDGLAQME 1820
            SC  ++  ++  FQ + LA       L +L+  L+  +LD R+  +++G Q+++++N+L++K+L+ +D+T+    L+ LL+    +   SP           KFS+LV+KCL ++ ++L  TI  ++LDRIL  IH++++    E++++     + P+R +KT+LH L KL+G  I  HL++  ID K +  + A++          RM+      TG       + GA+       S+ A++   LA IFKKIG K+    GL ELY   + Y   DI   L+N+S+ F++Y+  GL  +E
Sbjct: 1615 SC--IIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILSALLVLLQDSLLATASSP-----------KFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQ--CKSEFPIRTLKTLLHTLCKLKGPKILDHLTM--IDNKNESELEAHL---------CRMMKHSMDQTGSKSDKETEKGASRID--EKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIE 1888          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: MTAA_DICDI (Centrosomal protein 224 OS=Dictyostelium discoideum GN=mtaA PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.899e-47
Identity = 151/495 (30.51%), Postives = 256/495 (51.72%), Query Frame = -1
Query: 4917 EDRLFHKNWKVRNEANIDLAALCDSITDPKDSRLRELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCDAIVAKCL-TGRPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNV-TGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAEL-TKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNK-AVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSV 6389
            EDR+ HKNWK R     +L     +  +       E  P FKK +AD N   QE+AL+ L AF+   D    ++       +V K   + RP+  EK     +L +E ++ E  ++++ K   +   K ++ ++  + QAL  FG K +P K ILK     F+++D+ +R  +  L +E+ RWIGK  +  ++ E +     K L+ +   + T  A P +  RSE        A    A      ++  +  +EID Y L+  V+IL P   S F++G++A KW ER E + +L T L +T KI   DF+E+C+ LKK++ DVN+ +  +A+ +IG LA  LR  F+   +  +  +LEK KEKK ++ +S+  T+  +     ++L+DI++++    ++KVP ++   L ++   I  + K A + KV K    I ME LND   ++RD A  A  A+   +G R +   L ++D ++ KK+ + +    + V
Sbjct:   12 EDRINHKNWKWRVSGLEELTTKFRNSIEGSGPLFNEWGPQFKKILADINPMSQERALEPLSAFIDRCDC-VNKFAASYVGVLVEKLFASTRPRAKEKTIECLLLTIEADSAEPVVEALLKGTSSTSPKILLASLAALTQALKTFGPKQIPVKLILKQFSPWFENRDKGIRDQASELFIEIYRWIGKALI-PLISEALTPIQLKALQDQFEKLPTDPAVPLKYTRSE--------AAKALANASKGIQAKPEVVEEIDPYSLMTAVNIL-PKLTSEFYEGLQAKKWQERSEQMDKLVTILTNTPKIETADFSELCKALKKILADVNVMIVQKAVVSIGLLADSLRGGFTSYVKPFITPILEKFKEKKTSVLQSVHTTMDSL-VGKSISLSDIIDELTATMQSKVPQIKQEVLVFICNSITNTKKPADITKVTKQLTKIFMEALNDTDSNIRDNASKAFAALGGIIGERAMTPYLNQIDPIKAKKIKDNMPAVATPV 494          

HSP 2 Score: 176.022 bits (445), Expect = 1.829e-42
Identity = 131/485 (27.01%), Postives = 251/485 (51.75%), Query Frame = -1
Query: 3231 GSLIQADVISQLKSAVWKERLEAIFSLKEQVEGL--QDLDRSVEILVYLLCAIPGWNEKNXXXXXXXXXXITYLANSAAKFPK-KCVVLCLLGISERVADMKTRAHAMKCLTAFSEAVGPGFVFERLYKIMKEHKNPKVLSEGLLWMVSAIEDFGVSHL-----KLKDLIDFCKDTGLQSSAAATRNATIKVLGALHKFVGPDIKGFLTDVKPALLSALDVEYQKNPFEGTSTAPKKTVRLSEPSSLSAGGLDGLPREDISAKITPTLLKSLESPDWKVRLESIEAVNKILEEANKRIQPTGTGELFGALRGRLYDSNKNLVMATLTTVGNVASAM-GPGVEKASKGILSDILKCLSDNKKHMRESTLSTLDAW-NAAVHFDKMVPYITSALTDSKLGAEGRKDLFDWSSRQLSGL--SEFPDAVHLL-KPAATAMMDKSADVRKAADGCV----TEILRVSGQEAIEKNLRDIQGPALALILER 4634
              ++  ++I  L    WK+RL+A+  + E V+GL    ++   E ++ LLC  P   E N QV   +  +      + + F + +C    L    E++ D+K +  + + L +  E++ P  VF  +Y+    HKNPK++++ L+W+  AI++FG+        +LK L+D+ K   L+S+    + + IK+L  +   +G  +  FL DVK   +  LD E+QK   +      ++   +  P   SA      PR DIS K+TP ++ +L   +WK R ++++ + +I+ +AN++IQP   G L  AL+ RL D+N+   + TL  +G ++ AM G   EK ++ ++  IL  L D+KK +R++ +S ++    + + FD  +  + + +      A  RK+   W+   ++ +  +  P  ++ L K   + + DKSA++R  AD  +    T+I  +  ++ + K+++    P++  IL++
Sbjct:  562 AGIVNNEIIEGLGKTQWKDRLQAVDDILENVKGLTADSINGMSESIIQLLCDKPSLKESNFQVLSSIFSIFIQCCKNDSNFTQQRCANSYLTTCIEKLTDVKLKEISSELLFSTGESITPHAVFTSIYQFTSNHKNPKIIADSLVWIQQAIDEFGIGCCSNGIQQLKPLLDYTKQC-LESTNPDVKKSAIKLLCTIKINIGATLTDFLGDVKKPTMEVLDREFQKIRDQKPPVPNRQWKGMPPPG--SAPVQIEFPRVDISVKLTPAIITNLSDANWKTRSDALDEIERIIIDANRKIQP-KLGGLIPALKNRLTDNNQKCTITTLNIIGMLSQAMGGQSFEKHARLLIPGILLLLGDSKKPVRDAVISCMNVIVQSDLGFDVFIGSLAAPMIQE--SAFTRKESLAWTIVNVTNMKAAPIPSEINTLAKGIISCLQDKSAEIRSLADNLLSILCTQIPLIEFKKEL-KHVKPASQPSIQTILDK 1039          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: ALP14_SCHPO (Spindle pole body component alp14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp14 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.181e-39
Identity = 154/522 (29.50%), Postives = 246/522 (47.13%), Query Frame = -1
Query: 4887 PWEDRLFHKNWKVRNEANIDLAALCDSITDPKDSRL---RELAPFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKEVCD-AIVAKCLTG-RPKTVEKAQAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNV-TGAAKPSRKIRSEQDREPEPEAVSEAAGPGPTEESLADTPQEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVT-DVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVT------------FCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEMIAGSGSSVPGATSSAAVK 6395
            P E R+ HK WKVR  A  + +       D  D+        +  +K  + DSN   QE    A +A+ + +D       +E+   +I  KCLT  R  T E A  A ML VE ++    ++S+  ++  +  K +   +  +   + +FGAKV+P K I+  +  LF H D+NVR  +  LT+ + RW G DP+K +LF+ +R    KELE+    + T   K +R ++S+Q    EP   ++       E   ++     D+++LV+ VD+L P         + + KW +RKEA+ +L  + S  KI   DF  +   L K V+ D NI V + A   I  +A+GLR++FS  +   +  LLE+ KEKK  + ESL+  +  +     L+  D+ E + + + NK P ++S   +  +            F ++T  KA V  V   + P            VR AA  AL  + K VG R + + L  LDD+RK K+      +       T  + VK
Sbjct:   13 PLESRIVHKVWKVRLSAYEECSKSFSLSADGSDNCFELWNNQSELWKSVLTDSNVAAQEAGTAAFVAYCRFSDPSHLLKAREISVLSISEKCLTSPRAGTRENALEALMLLVEADSAAPVIESIIPSLSARSPKVIASNVAAIASLVEQFGAKVIPSKMIIPHISNLFGHADKNVRKEASRLTVNIYRWTG-DPLKDLLFKDLRPVQTKELESLFAELPTEPPKQTRFLKSQQPTS-EPNVETQVEEQPALENEESEPEPSDDQFDLVEEVDVL-PNVDPNLETLMASSKWKDRKEALDKLLPVLSQPKIKDNDFFNLVAILTKSVSKDANIMVVINAAHCIQAMAKGLRSNFSKYASTSINALLERSKEKKANVIESLSSAMDAVLATSSLD--DLAELIASFAGNKNPQIKSSCFSLFSRSFSNMTSLPSKFTVDTCAKACVPGVSDTFEP------------VRSAAAEALGVLMKLVGERAINQYLSPLDDIRKSKIRSFYETATVKAKAPTKKSKVK 517          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: DIS1_SCHPO (Phosphoprotein p93 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis1 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.370e-22
Identity = 130/520 (25.00%), Postives = 232/520 (44.62%), Query Frame = -1
Query: 4941 RLFHKNWKVRNEANIDLAALCDSITDPKDSRLREL---APFFKKTVADSNAPVQEKALDALIAFLKAADADAGRYGKE-VCDAIVAKCLTGRPKTVEKA-QAAFMLWVELEAVEAFLDSMEXXXXXXXXXXXXXAIDVMFQALSEFGAKVVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDRE------------PEPEAVSEAAGPGPTEE---SLADTP-----QEID-----EYELVDP---------VDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTKKIAPGDFTEVCRTLKKLVTDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFCIETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKLSEM 6383
            ++F K+WKVR EA   L    +   D  D   +        +K+ + DSN P QE A+ +L  FL  +        K  V   ++ KCL    +++  A   A ++  + +A++  L+ +  A + K  K  V +I  +   L  FG   + P    K++P LF   D+N+R  +  L++ L  W+G +  K+ +F +++     +LEA   NVT        I +  + +            P+P   S+++  G T +   S   TP     Q  D        +V P         VD+L+ L    F   + + KW +RKEA+  +  + S      GD++E+ R + K + D N+ V   A   + ++A+ LR  F   +  +LP L ++ KE+K +L  SL      + ++  LN  DI+++     K+K P V++ TL W+  C++ ++        +    +C+  +ND    VR A  + L  + +      L + +  LD  +  K+ E+
Sbjct:   13 QIFDKSWKVRFEAYESLLHALNRALDDSDVCFQPWIHDPALWKQGLCDSNVPTQEHAVKSLRCFLDKSRQKGVNSAKSFVVAPLLEKCLPSPRQSIRDASHQALLILAKSDALDYVLEGLFSAARVKHPKQAVASIKELNSLLENFGIPALSPIPFYKLIPTLFAQSDKNIRQEASNLSITLYAWVG-NAFKTHVFPQLKQIQVSDLEASFQNVTSRTTTGGHISNSLNTQEVVLPSFSSNAKPKPHLSSKSSSQGNTLQRSTSSFSTPNRKVSQPSDFSASPSRSIVSPAKNIVGSTPVDVLSKLTPE-FHTALSSPKWKDRKEALESMVPVCSNPVYQEGDYSELLRVIAKSLKDANVVVVGVAALLLTHIAKALRKGFLPYTGIVLPSLFDRFKERKSSLVHSLLDAANAIFESCGLN--DIMDETLEFLKHKNPQVKTETLRWLNRCLQLTDVCPPRASLETLCSLCVTLINDTFEPVRMATTNVLATLVQIFSQPVLSKYIVGLDPKKLPKILEL 528          
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Match: ZYG9_CAEEL (Zygote defective protein 9 OS=Caenorhabditis elegans GN=zyg-9 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.467e-7
Identity = 96/347 (27.67%), Postives = 167/347 (48.13%), Query Frame = -1
Query: 4950 KRILKMLPELFDHQDQNVR-ASSKGLTLELCRWIGKDPVKSILFEKMRDTMKKELEAELVNVTGAAKPSRKIRSEQDREPEP-----------EAVSEAAGPGPTEESLADTP-QEIDEYELVDPVDILTPLEKSGFWDGVKAIKWSERKEAVAELTKLASTK-KIAP-GDFTEVCRTLKKLV-TDVNIAVAVEAIQAIGNLARGLRTHFSGSSRFXXXXXXXXXXXXXXXXXXXXTQTLQGMHKAGCLNLADIVEDVKTASKNKVPLVRSLTLNWVTFC-IETSNKAVVLKVHKDYVPICMECLNDGTPDVRDAAFSALTAVAKSVGMRPLERSLEKLDDVRKKKL 5939
            K ++ +  +L    DQ+VR AS +GL   + R IG   VK++L +   D  K +   E      A K +     EQ +   P            A  + +G   T    +  P  E D ++ +D  D+L+ +   GF   +++ KW ERKEA+  L +L +   K+ P  ++  +   L+K++  D NI VA  A   I  +A GLRT F   +  + P++ EK KEKKPTL + L   +  +      NL  + E V  A     P +++ T  ++  C ++ +++ +  K  K  +P  ++   D   +VR+A+++A+ A+ +++G +P   SL+ L D+    L
Sbjct:  177 KAVVPVFGKLTGDADQDVREASLQGLG-AVQRIIGDKNVKNLLGDASSDEGKMKKIGEY-----AEKSTASFAEEQAKNAPPVAPTSSTPSASAASGDPSGGTATAVVSSGAPVAEADPWDFLDAFDVLSKM-PDGFDTNIESKKWQERKEALEGLLQLITANPKLDPKANYGALVERLQKVLEKDANINVAALAANCITGIANGLRTKFQPFAVSVTPIIFEKFKEKKPTLRDPLVACIDAV--VATTNLEAVGEIVLAALGKPNPSIKTQTDLFLQRCFMKLNSQTMPKKTLKTLIPSLIKHSGDSDSEVREASYAAMGAMMRAIGEKP---SLQLLADIASDNL 511          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TNR6_GOSRA0.000e+098.56Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RZ17_GOSRA0.000e+098.41Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QE35_GOSRA0.000e+098.59Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GFC7_THECC0.000e+090.63ARM repeat superfamily protein OS=Theobroma cacao ... [more]
B9GIF2_POPTR0.000e+083.46MICROTUBULE ORGANIZATION 1 family protein OS=Popul... [more]
V4UCX1_9ROSI0.000e+083.50Uncharacterized protein OS=Citrus clementina GN=CI... [more]
B9I0T7_POPTR0.000e+083.27MICROTUBULE ORGANIZATION 1 family protein OS=Popul... [more]
A0A067GFS8_CITSI0.000e+083.45Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067GD46_CITSI0.000e+083.50Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067GQB7_CITSI0.000e+081.92Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0000053 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
MOR1_ARATH0.000e+075.28Protein MOR1 OS=Arabidopsis thaliana GN=MOR1 PE=1 ... [more]
MOR1_ORYSJ0.000e+071.21Protein MOR1 OS=Oryza sativa subsp. japonica GN=MO... [more]
CKAP5_MOUSE1.571e-14930.73Cytoskeleton-associated protein 5 OS=Mus musculus ... [more]
CKAP5_HUMAN5.424e-14930.50Cytoskeleton-associated protein 5 OS=Homo sapiens ... [more]
MTAA_DICDI1.899e-4730.51Centrosomal protein 224 OS=Dictyostelium discoideu... [more]
ALP14_SCHPO4.181e-3929.50Spindle pole body component alp14 OS=Schizosacchar... [more]
DIS1_SCHPO1.370e-2225.00Phosphoprotein p93 OS=Schizosaccharomyces pombe (s... [more]
ZYG9_CAEEL3.467e-727.67Zygote defective protein 9 OS=Caenorhabditis elega... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1272..1299
NoneNo IPR availableSMARTSM01349TOG_3coord: 274..513
e-value: 2.8E-61
score: 219.6
coord: 591..825
e-value: 9.6E-53
score: 191.2
coord: 1..233
e-value: 2.0E-42
score: 156.9
coord: 846..1079
e-value: 4.7E-42
score: 155.7
coord: 1169..1404
e-value: 2.3E-49
score: 180.0
NoneNo IPR availablePANTHERPTHR12609:SF0CYTOSKELETON-ASSOCIATED PROTEIN 5coord: 1..1946
coord: 1986..2023
NoneNo IPR availablePANTHERPTHR12609MICROTUBULE ASSOCIATED PROTEIN XMAP215coord: 1..1946
coord: 1986..2023
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 36..90
e-value: 1.4E-35
score: 122.6
coord: 1269..1385
e-value: 1.6E-62
score: 211.6
coord: 698..1072
e-value: 1.6E-62
score: 211.6
coord: 281..481
e-value: 1.4E-35
score: 122.6
coord: 636..695
e-value: 1.4E-35
score: 122.6
IPR024395CLASP N-terminal domainPFAMPF12348CLASP_Ncoord: 298..474
e-value: 6.8E-11
score: 42.0
IPR002014VHS domainPROSITEPS50179VHScoord: 860..982
score: 8.918
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 446..484
score: 10.349
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 1641..1678
coord: 852..1061
coord: 1526..1607
coord: 1167..1392
coord: 608..795
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 296..491
coord: 18..217

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0000053 ID=g.arboreum_cottongen_reftransV1_0000053|Name=g.arboreum_cottongen_reftransV1_0000053|organism=Gossypium arboreum|type=contig|length=6584bp
ACGGGGTTTAATTGCAATTTACGGGCAAATCAAATCACAATTACAAAGTT
ATCAATATTGTAAAGCCAACGTTTGATTCCATCCCATCCAACTCTTGCAA
CAAAATTTTAGTCTATCACCAAATACCTACCTATGCCTGAATTACTAATG
TCGAACAGAAATAGAATTCATGAAACCAGCGTATCGCATTTTCTAAAATT
AAAGAAAATTCGGTACAGCTAAATCTACTTGGCTGGCATTTCAACCAAGA
ACAGGAGAAACAGTGGCTGCTTTCGATGGGTAACTGCGGTATGTTAATTC
CCTTCCATTTACAAGAACGGCTTTCGATGGCAGGCCTAGAAAAAAGCATA
AAAAGAATATTTTTAAAGAGGTTCAAGTGCTCCCCCACTCTTTAGTCTTT
CCATCCGTGCCTGGAGCCCAGACAATGCCTTCTCATCCATAGGAAGTACA
CCTCCTTGTGCCGGATTCTCCATACCAGGATGAGGATCTAATGTACGTGT
CTGAGATGAGAGTCCAAGATTTAAGTTGTCATTGACAGACATCAAGGGCC
TGGTTCCATAATCATCTATGTTCCCACCGGCAGCTGCTAGTTGCATACTC
TTCATCCTCTCTCTGATTGCGTCCAATGTGCCACTGGTTACCCCACTGAT
AAATCTCTCATTTCTTTGGTCTGCCAATGCATTTTCAGGGGCACGAACTC
TTGCTGTATTTACAGCATTACCACTCCCCCGATTGTCTTCAGTGTATGAT
GGTGGCAAATTAAAGCTTGTTGGTTCAGGTTTTGTACTTGATAATTTAGA
ATCATTTAAAGAGTTGGTCTGAACAGGGGACAGAGGCCCAAATTCAGGTG
ACGAAGAAGAAAGAGAAGCAGGGGGAGGGGTTGACATTGGCACACTTGAA
GGAGTCCTTCCTGCTGCAGCATTCTTCTCCATCTGAGCTAAGCCGTCTCT
AATATAAGTCCGAAATGCCTCACTAGCATTTTGGAGCTGAGCAAATATAT
CAACCTTAGGGTATAGCTGAGTGATGCGATAAAGCTCATAGAGACCAATT
GTGCATGTCTGCTTGTCACCAATTTTCTTAAATATTGCTGCGAGTTCTTG
TTTTAGCTGGGCATCAGCAGAATTTGTGGCAGGTGCTGGATTGTTGGCTC
CAGAATCACCCCAATGAGTTTGACCAGGGCCAGTTGATGTCAACATTCTT
GCCGCAGCCAAAGTCTCAAGATTGAGATCAATATAGGCAAGAATAATTGG
TTGAGGCTTCATGTCTATGGGCACCAAAGATAGGTGACCCTTTATTGCAG
CCCCTCTAAGTTTGACAAGTTCATGTAGAACAGTTTTTACCATTCGTAAT
GGTTTATCATCAGCTCCAGCTCTTCTCCGGATTTCTTCCATTCCTAGTTC
TTGCAGGTAGACATGGATACTTTGAAGGATGCGGTCAAGATCAACATCAT
AAATTGTGCTTTGAAGAACCTTTGTGAGTTTGATAAGGCATTTGACAACC
AGATCAGAGAACTTCTGATTTCTTGCTGCAAAAGTCTCATTTGTTGCAGG
TGAAGGCCATCTTGAAGGATCTAAAGGACGTAATAGATTAATTAGGACGA
CAAAGGATGAGGTTCGATCAGCATTATCCAGAATTTTAAGCATCAAGACA
TTCAGAGCTTTCAGAAGTTGGCTGCCATCATCCATATGGGGAACCCTTTC
ATCCAAAAGCCAAAGCAGAAGCTCTGTAATAAGGTTGTCAAGAGTGTTTT
CCTTGACAGCATGTGCAAGTCTCTTATTTTGAAATGTCTGCATAAGCGTG
TTTAGAACATATTTACAAGATCTTGATGATGCACCAGTCAAACTGAAGTC
AAAAGTTTTGGCTACCTTATTTGCCAAGCATGAAACGAGTCTATCTGCAT
CCTTCATTAGTTCATCCATCAAACTGCCTTCTGGGTCATTAGTGGCCTGT
GTTAACTCATGGCAGACAACTTTCATTCCCTCAACAGACTGCTCAGGAGA
GCCAAAAGAAATGATATCAAGAGCTTCATTCCAGTTTGAGGGACCACTGA
CACCAACAAGCATCCGAGGCGTTAAATGTCTCTCCATGTTAAGGTCAGGT
TGCACATAGTTTTTCCTGGAAATAGTCTGTGGAACTTCACAACTCTGCTC
AGCTACATCAGGTCCATTTTCCCTTACTGATCGCCTTAGAGCAGCTCTTG
CTTCACCAGGTCGGCCTTCCCCTCTTTTTTCCATCTCTCGAACCTTCCAC
TTAAATCTATCATCTAGCATGCTTTTTTGAGCATCTGTCAGCTTCCCTAC
ATATCTCCATATGTCATCACCAAGAATCTTATATCCAGTAGCTAGTGTAT
TTAGGGCAGCCTTCCTAATTTCACCATCTCGTTCTGCTGTCAAGCTTGCA
ACAATTTGCAATGATTTTAGTTGTCCACTTATCTCAGCCCCATGATGATC
AATAAAGAAACCAACAAGATCAACACATTCTATCCTAGTACGATTGTTCT
TTGAACGAAGACCATCCAAAATGTAAGTGTAGATTTTTGTGGCTGAATAC
ACTTGAACTATTTGCTTTGTCAGCTCCCGCATTTTTTCTCTAACTTTCTC
AATGTTATGCCCCAACTTTTCTGCCAAGCATGGAAGAAAAATGGCAGCTT
CTGCCTCCGTCAAACTATATGCTTCACCCTTCAACGAGTCAAAAAGTTCT
GGAAGAAACTCCAGCACCTTCAAAAGGCATGTCGTGTTAGATTTACATAG
CTGCAAAACAAACCACCTCAATAGTATGTCCAGAACTTCAATTATTTCCT
TCCCAATGGAAGGGAGTGCCTTCTGTAACATCTCAAGACCATCAACTTGC
TTCTTGAAATCGGTGCTCAATAAGCGCCTATGTAGATCCTCTCTGAAATA
CTTCATCATATCATTCTCAAGATCTTGGATCTGTTCAATTCGTGGCTCTT
CAAACTTCGACCTTCGAACCATTCTCTCCCTTTCCTCCTTATTTGAATCC
TTGACATTCAACAAAGCTTGAGGCTGAACAGATATGCCTTGAACAGGTAA
CATGGTATCTGGTTTCAATCCCTTCGCTGGGATGGCTCTCGAAGTTACAG
TTCTATTGCCATGTTTTGTGACACCATTGGAAGTAGCTTTTGCAACCTTT
GTGTTGGTTTTTGATACCAGTCCAATAGAACCTCCTTTGGATGGTTCAAC
TAATTCTTGGAAAGACCCATAAGGTTTTACCCGCTCAAGGATAAGAGCTA
AAGCTGGCCCTTGTATATCTCTAAGATTCTTCTCAATTGCTTCCTGCCCG
CTAACTCTTAAAATTTCAGTAACGCATCCATCTGCTGCTTTGCGAACATC
CGCTGATTTATCCATCATGGCTGTGGCTGCTGGTTTGAGCAGATGCACAG
CATCAGGAAATTCACTAAGTCCAGAGAGTTGCCTAGATGACCAATCAAAA
AGATCTTTACGTCCTTCCGCCCCAAGCTTGGAGTCTGTTAGTGCTGATGT
GATATAAGGAACCATTTTGTCAAAATGAACAGCTGCATTCCAAGCATCTA
AAGTAGACAAAGTGCTCTCTCTCATATGTTTCTTATTGTCGCTAAGGCAT
TTCAAAATATCTGATAGTATTCCCTTGCTTGCTTTCTCGACACCTGGTCC
CATTGCAGATGCAACATTTCCAACGGTAGTCAAAGTTGCCATAACCAAAT
TTTTGTTGCTATCATATAGCCGGCCCCTAAGAGCACCAAATAGCTCTCCA
GTTCCAGTAGGTTGAATGCGCTTGTTAGCCTCTTCCAAAATTTTATTGAC
AGCTTCAATAGACTCCAAACGCACCTTCCAATCAGGACTCTCCAAGCTCT
TTAACAGGGTAGGAGTGATCTTCGCACTAATATCTTCACGTGGCAGACCA
TCTAGTCCACCGGCAGACAAAGAGGATGGTTCTGATAACCTGACAGTTTT
CTTTGGAGCAGTGGAAGTACCCTCAAATGGATTTTTTTGATATTCAACAT
CCAGTGCACTAAGCAATGCAGGTTTGACATCAGTAAGAAACCCCTTGATA
TCTGGACCAACAAACTTATGTAAAGCACCCAAAACCTTAATTGTAGCATT
TCGGGTGGCTGCAGCACTCGACTGCAATCCAGTATCTTTACAAAAATCAA
TTAGATCCTTCAACTTCAGATGTGATACACCAAAATCCTCGATAGCGGAG
ACCATCCACAATAAACCTTCACTAAGAACCTTGGGATTCTTGTGTTCTTT
CATTATTTTATAAAGCCTTTCAAAAACAAATCCTGGACCTACTGCCTCGG
AGAAAGCAGTGAGGCACTTCATAGCATGAGCACGAGTCTTCATATCTGCC
ACTCTTTCACTTATACCAAGAAGGCAAAGAACAACACATTTCTTTGGAAA
TTTTGCAGCACTGTTGGCCAGATAAGTGATAACTTCAATAACTTGCTGCT
GGACCTGAACATTTTTCTCATTCCATCCAGGAATAGCACATAGCAAATAA
ACCAAAATCTCAACAGACCGATCAAGGTCCTGGAGACCTTCAACCTGTTC
TTTCAGCGAGAATATGGCTTCAAGACGCTCTTTCCATACAGCACTCTTCA
GTTGAGAAATGACATCTGCCTGAATGAGGGAACCTATTCTGCTTTCAATC
TCTTCAAGACTCATTTCTGCTGGCTCAATGTCCTCAGGCGACTCACTCGA
CTTTGCAGTTTCCGTCCGTCCAGCTCCATCTACCTTTTTACTGTTGCCTG
ACTTCGCTGAAGTCCCTTTCTTGTTGGCAGGAGCTGCAGGGGCAGGCCTC
TTCCCACTAAGCATGCTAGCTGCAGATTTCTTAACAAATGAACCTTCAGA
CACCTCTGTAGAAGACACACCACCACCTCCTGAATTTTTTACAGCAGCTG
AGCTTGTAGCACCAGGTACAGAAGAACCAGATCCAGCAATCATCTCAGAG
AGCTTCTTTTTTCTAACATCATCAAGTTTCTCCAAAGATCTCTCTAATGG
CCTCATACCGACAGACTTAGCAACAGCTGTCAGTGCTGAAAAGGCTGCAT
CTCGGACATCGGGGGTCCCATCATTAAGACACTCCATACAGATTGGGACA
TAATCCTTATGCACCTTCAGAACAACAGCTTTGTTACTTGTTTCGATACA
GAATGTCACCCAGTTCAAAGTTAAAGAACGCACAAGAGGAACTTTGTTTT
TAGATGCAGTTTTAACATCTTCCACAATGTCTGCCAGATTTAAGCACCCT
GCTTTGTGCATTCCTTGAAGAGTTTGTGTGAGTGACTCAGTCAAAGTAGG
TTTTTTCTCTTTCAATTTTTCAAGTAAAACTGGCAACAAAAAGCGCGAAC
TACCAGAAAAATGGGTCCGCAAACCCCGAGCAAGATTTCCAATAGCTTGG
ATGGCTTCAACTGCAACAGCAATGTTTACATCTGTAACAAGCTTCTTCAA
CGTCCGGCAAACTTCCGTAAAATCACCCGGAGCTATCTTTTTTGTTGATG
CAAGCTTTGTGAGTTCAGCAACAGCCTCCTTTCTTTCTGACCACTTGATA
GCTTTCACTCCATCCCAAAATCCAGACTTCTCCAGAGGAGTTAATATATC
AACTGGATCAACAAGCTCGTATTCATCTATTTCCTGAGGAGTATCAGCTA
GAGATTCTTCAGTGGGGCCAGGACCAGCAGCTTCAGACACAGCTTCAGGC
TCTGGTTCCCTGTCTTGCTCGGACCTTATCTTCCGAGATGGCTTGGCTGC
CCCAGTCACATTCACAAGCTCAGCTTCAAGCTCTTTTTTCATAGTGTCAC
GCATCTTCTCAAACAATATTGACTTGACAGGATCCTTTCCAATCCAACGA
CAAAGCTCAAGAGTCAGCCCTTTGGAGGATGCACGGACATTTTGATCTTG
ATGGTCAAAGAGTTCAGGAAGCATCTTTAGAATTCTTTTAGGTGGAACAA
CTTTGGCTCCAAATTCACTTAGCGCTTGAAACATGACATCAATTGCAGGC
ACCACTGCTTTGGCAACTTTATTCTTAATGGCCTTCTCCATTGAATCCAG
AAAAGCCTCTACAGCCTCCAATTCCACCCAGAGCATGAACGCTGCCTGAG
CCTTCTCGACAGTCTTAGGCCTGCCTGTGAGACATTTCGCCACGATGGCA
TCGCATACTTCCTTCCCATACCTTCCGGCATCAGCGTCGGCCGCTTTTAA
GAACGCAATCAGAGCATCCAACGCCTTCTCCTGCACCGGAGCATTCGAAT
CCGCCACTGTCTTTTTGAAAAATGGAGCTAATTCGCGGAGCCTCGAGTCC
TTCGGATCCGTGATGGAATCGCATAGAGCAGCTAAATCGATGTTAGCCTC
GTTCCTTACCTTCCAATTCTTGTGAAACAACCGATCTTCCCATGGCAATT
TCTTTGCCTCCTTTAACAATTTCTCTTCTTCAGACATTTTATTTCTACTT
TTCTTTAAATTTTTTTTCTATCAACGATTTGATCTATCCAAATGCAGAGC
TCCAAAACAAGAAGAGATATTTTATATTTTCTTCTTATTTTTCTTTTCTT
TCTTCTTCTTTCTTTTTTTTTTTTTTTTTTTTTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR024395CLASP_N_dom
IPR002014VHS_dom
IPR021133HEAT_type_2
IPR016024ARM-type_fold
Vocabulary: Biological Process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding