g.arboreum_cottongen_reftransV1_0002791, g.arboreum_cottongen_reftransV1_0002791 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0002791
Unique Nameg.arboreum_cottongen_reftransV1_0002791
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length352
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold2748supercontigg.arboreum_cottongen_reftransV1_0002791:1..352 .
scaffold2748:30925..31276 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A0B0PGS2_GOSAR (Synapse-associated of 47 kDa OS=Gossypium arboreum GN=F383_32776 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.286e-41
Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALXXXXXXXXXXXXXXXXXXXXXPPQLSSLSIASSD 352
            MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALKQADQIQLQSQSLSKSISDIIPPQLSSLSIASSD
Sbjct:    1 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALKQADQIQLQSQSLSKSISDIIPPQLSSLSIASSD 103          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A0D2TYJ7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G097600 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.621e-38
Identity = 98/103 (95.15%), Postives = 102/103 (99.03%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALXXXXXXXXXXXXXXXXXXXXXPPQLSSLSIASSD 352
            MEDFW+RAKSFAEETAKKSQTLTMPNKIADLVA+TAKKSKELA EASKKADELALEASKKADEL+VAALKQADQIQLQSQSLSK+ISDIIPPQLSSLSIASSD
Sbjct:    1 MEDFWKRAKSFAEETAKKSQTLTMPNKIADLVAETAKKSKELALEASKKADELALEASKKADELKVAALKQADQIQLQSQSLSKTISDIIPPQLSSLSIASSD 103          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A0D2U500_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G175300 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.624e-22
Identity = 50/69 (72.46%), Postives = 61/69 (88.41%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAAL 250
            MEDFW+RAKSFAEE AKKSQTLT PNK+ADLVA+TAKKSKELA EA+KKADEL   A K+AD++++ ++
Sbjct:    1 MEDFWKRAKSFAEEAAKKSQTLTSPNKLADLVAETAKKSKELAVEATKKADELKTAALKQADQIQIQSI 69          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A0D2RH36_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G175300 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.819e-22
Identity = 50/69 (72.46%), Postives = 61/69 (88.41%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAAL 250
            MEDFW+RAKSFAEE AKKSQTLT PNK+ADLVA+TAKKSKELA EA+KKADEL   A K+AD++++ ++
Sbjct:    1 MEDFWKRAKSFAEEAAKKSQTLTSPNKLADLVAETAKKSKELAVEATKKADELKTAALKQADQIQIQSI 69          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A0D2PWJ3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G175300 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.010e-22
Identity = 50/69 (72.46%), Postives = 61/69 (88.41%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAAL 250
            MEDFW+RAKSFAEE AKKSQTLT PNK+ADLVA+TAKKSKELA EA+KKADEL   A K+AD++++ ++
Sbjct:    1 MEDFWKRAKSFAEEAAKKSQTLTSPNKLADLVAETAKKSKELAVEATKKADELKTAALKQADQIQIQSI 69          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: B9HWU3_POPTR (BSD domain-containing family protein OS=Populus trichocarpa GN=POPTR_0010s14770g PE=4 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.347e-21
Identity = 61/104 (58.65%), Postives = 73/104 (70.19%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMP-NKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALXXXXXXXXXXXXXXXXXXXXXPPQLSSLSIASSD 352
            MED W RAK FAEE AKKSQTLT   NKIADLVA+TAKKSKELA EASKKADE  + A K+AD++++ ++                 SDIIPPQLSSLSI +++
Sbjct:    1 MEDLWNRAKVFAEEAAKKSQTLTTSSNKIADLVAETAKKSKELALEASKKADEFKVAALKQADQIQIKSI-----------------SDIIPPQLSSLSIVNTN 87          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A067K5A0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_11782 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.504e-21
Identity = 50/69 (72.46%), Postives = 59/69 (85.51%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAAL 250
            MED W+RAK FAEETAKKSQTLT  NKIADLVA+TAKKSKELA EASKKADEL   A K+AD++++ ++
Sbjct:    1 MEDIWKRAKLFAEETAKKSQTLTSSNKIADLVAETAKKSKELALEASKKADELKTAALKQADQIQIKSI 69          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: A0A061EGZ4_THECC (BSD domain-containing protein, putative OS=Theobroma cacao GN=TCM_011442 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.051e-20
Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKAD 229
            MEDFW+RAKSFAEE AKKSQ+L  PNKIADLVA+TAKKSKELA EA+KKADEL   A K+AD
Sbjct:    1 MEDFWKRAKSFAEEAAKKSQSLATPNKIADLVAETAKKSKELALEATKKADELKTAALKQAD 62          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: B9HIU7_POPTR (BSD domain-containing family protein OS=Populus trichocarpa GN=POPTR_0008s11110g PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.771e-20
Identity = 58/104 (55.77%), Postives = 71/104 (68.27%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMP-NKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALXXXXXXXXXXXXXXXXXXXXXPPQLSSLSIASSD 352
            MEDFW+RAK FAEE AKKSQT T   N IADLV +TAKKSKELA EASK+AD+L + A K+AD ++  ++                 SDIIPPQLSSLSI +++
Sbjct:    1 MEDFWKRAKVFAEEAAKKSQTFTTSSNTIADLVTETAKKSKELALEASKRADQLKIAALKQADSIQFKSI-----------------SDIIPPQLSSLSIVNTN 87          
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Match: M5XHY2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa020847mg PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.490e-19
Identity = 56/102 (54.90%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   44 MEDFWQRAKSFAEETAKKSQTLTMPNKIADLVADTAKKSKELAFEASKKADELALEASKKADELRVAALXXXXXXXXXXXXXXXXXXXXXPPQLSSLSIASS 349
            MED W+RAKSFAEE AKKSQTLT   KI DLV++TAK+S+E A EASKKADE+   A K+AD+++  ++                 S+IIPPQLSSLSI +S
Sbjct:    1 MEDLWKRAKSFAEEAAKKSQTLTNSAKITDLVSETAKRSREFAAEASKKADEIKTAALKQADQIKSLSV-----------------SEIIPPQLSSLSIVNS 85          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PGS2_GOSAR3.286e-41100.00Synapse-associated of 47 kDa OS=Gossypium arboreum... [more]
A0A0D2TYJ7_GOSRA3.621e-3895.15Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2U500_GOSRA1.624e-2272.46Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RH36_GOSRA1.819e-2272.46Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PWJ3_GOSRA2.010e-2272.46Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9HWU3_POPTR1.347e-2158.65BSD domain-containing family protein OS=Populus tr... [more]
A0A067K5A0_JATCU3.504e-2172.46Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A061EGZ4_THECC3.051e-2079.03BSD domain-containing protein, putative OS=Theobro... [more]
B9HIU7_POPTR6.771e-2055.77BSD domain-containing family protein OS=Populus tr... [more]
M5XHY2_PRUPE5.490e-1954.90Uncharacterized protein (Fragment) OS=Prunus persi... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0002791 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31923:SF7BSD DOMAIN-CONTAINING PROTEINcoord: 1..103
NoneNo IPR availablePANTHERPTHR31923FAMILY NOT NAMEDcoord: 1..103

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0002791 ID=g.arboreum_cottongen_reftransV1_0002791|Name=g.arboreum_cottongen_reftransV1_0002791|organism=Gossypium arboreum|type=contig|length=352bp
AGAAGATCAAAAGAATCAAATCCATCCGATTCAAATCCCAAAAATGGAAG
ATTTTTGGCAGCGCGCCAAGTCCTTCGCGGAAGAAACGGCGAAGAAATCT
CAGACCCTAACAATGCCAAACAAAATCGCGGATCTAGTCGCCGACACCGC
TAAGAAGTCCAAGGAGCTTGCTTTTGAAGCCTCCAAGAAAGCCGATGAGC
TGGCTCTTGAAGCTTCCAAAAAGGCCGATGAGCTCAGAGTCGCCGCTCTC
AAACAAGCCGATCAAATCCAACTCCAAAGCCAAAGTCTCTCCAAGTCCAT
TTCCGACATTATCCCTCCTCAACTCTCCTCCCTCTCCATTGCCTCCTCGG
AT
back to top