g.arboreum_cottongen_reftransV1_0001303, g.arboreum_cottongen_reftransV1_0001303 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001303
Unique Nameg.arboreum_cottongen_reftransV1_0001303
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length527
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0001303:1..527 .
Chr5:9702481..9703007 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A0B0MGL4_GOSAR (Putative histone-lysine N-methyltransferase ATXR3-like protein OS=Gossypium arboreum GN=F383_18336 PE=4 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.271e-101
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWKVAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKERHCSRSSRSHSTTSDVKKSSAESDSLSKAVNDQRLKGSWKVAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS
Sbjct:  954 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKERHCSRSSRSHSTTSDVKKSSAESDSLSKAVNDQRLKGSWKVAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 1128          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A0D2R6D4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G208600 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.454e-100
Identity = 172/175 (98.29%), Postives = 173/175 (98.86%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWKVAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKERH SRSSRSHSTTSDVKKSSAESDSLSKAVNDQRLKGSWK APINTPKDHVCT+DELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS
Sbjct:  957 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKERHSSRSSRSHSTTSDVKKSSAESDSLSKAVNDQRLKGSWKFAPINTPKDHVCTIDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 1131          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A061EAD1_THECC (SET domain protein 2 isoform 2 OS=Theobroma cacao GN=TCM_007803 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 7.288e-87
Identity = 151/176 (85.80%), Postives = 160/176 (90.91%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFS  EER+DC DISRSNQIKPS VRG KGTMLPVVRINACVVQDQGSFVSAPRTK R KER+ SRS+RSHSTTSD+KKSSAESDSLSKAV DQ LKGSWK +AP+NTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSS SELQ LVDQG I K+SS FRKYDQ+W+PVTS
Sbjct:  962 LPPWAFSSTEERSDCTDISRSNQIKPSVVRGAKGTMLPVVRINACVVQDQGSFVSAPRTKVRGKERYSSRSARSHSTTSDIKKSSAESDSLSKAVTDQGLKGSWKCIAPVNTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSLSELQVLVDQGAIQKHSSVFRKYDQVWIPVTS 1137          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A061E4G1_THECC (SET domain protein 2 isoform 4 OS=Theobroma cacao GN=TCM_007803 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 7.317e-87
Identity = 151/176 (85.80%), Postives = 160/176 (90.91%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFS  EER+DC DISRSNQIKPS VRG KGTMLPVVRINACVVQDQGSFVSAPRTK R KER+ SRS+RSHSTTSD+KKSSAESDSLSKAV DQ LKGSWK +AP+NTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSS SELQ LVDQG I K+SS FRKYDQ+W+PVTS
Sbjct:  962 LPPWAFSSTEERSDCTDISRSNQIKPSVVRGAKGTMLPVVRINACVVQDQGSFVSAPRTKVRGKERYSSRSARSHSTTSDIKKSSAESDSLSKAVTDQGLKGSWKCIAPVNTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSLSELQVLVDQGAIQKHSSVFRKYDQVWIPVTS 1137          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A061E2H4_THECC (SET domain protein 2 isoform 3 OS=Theobroma cacao GN=TCM_007803 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 9.452e-87
Identity = 151/176 (85.80%), Postives = 160/176 (90.91%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFS  EER+DC DISRSNQIKPS VRG KGTMLPVVRINACVVQDQGSFVSAPRTK R KER+ SRS+RSHSTTSD+KKSSAESDSLSKAV DQ LKGSWK +AP+NTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSS SELQ LVDQG I K+SS FRKYDQ+W+PVTS
Sbjct:  962 LPPWAFSSTEERSDCTDISRSNQIKPSVVRGAKGTMLPVVRINACVVQDQGSFVSAPRTKVRGKERYSSRSARSHSTTSDIKKSSAESDSLSKAVTDQGLKGSWKCIAPVNTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSLSELQVLVDQGAIQKHSSVFRKYDQVWIPVTS 1137          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A061E3M9_THECC (SET domain protein 2 isoform 1 OS=Theobroma cacao GN=TCM_007803 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.037e-86
Identity = 151/176 (85.80%), Postives = 160/176 (90.91%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LPPWAFS  EER+DC DISRSNQIKPS VRG KGTMLPVVRINACVVQDQGSFVSAPRTK R KER+ SRS+RSHSTTSD+KKSSAESDSLSKAV DQ LKGSWK +AP+NTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSS SELQ LVDQG I K+SS FRKYDQ+W+PVTS
Sbjct:  962 LPPWAFSSTEERSDCTDISRSNQIKPSVVRGAKGTMLPVVRINACVVQDQGSFVSAPRTKVRGKERYSSRSARSHSTTSDIKKSSAESDSLSKAVTDQGLKGSWKCIAPVNTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSLSELQVLVDQGAIQKHSSVFRKYDQVWIPVTS 1137          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A067DMR6_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000067mg PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.639e-68
Identity = 125/175 (71.43%), Postives = 148/175 (84.57%), Query Frame = -1
Query:    6 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVT 527
            LPPWA++  +ERND +  SRS Q K +AVRGVKGTMLPVVRINACVV D GSFVS PR+K R KERH SRS+RS+S+ +DV++SSAESDS SKA N+Q  +GSWK +A INTPKD +CTVD+LQL LGEWYYLDGAGHERGPSSFSELQ LVDQG I K++S FRK+D++WVP+T
Sbjct:   90 LPPWAYACPDERNDGSGGSRSTQSKLAAVRGVKGTMLPVVRINACVVNDHGSFVSEPRSKVRAKERHSSRSARSYSSANDVRRSSAESDSHSKARNNQDSQGSWKSIACINTPKDRLCTVDDLQLQLGEWYYLDGAGHERGPSSFSELQVLVDQGCIQKHTSVFRKFDKVWVPLT 264          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A067DAN1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000067mg PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.293e-68
Identity = 125/175 (71.43%), Postives = 148/175 (84.57%), Query Frame = -1
Query:    6 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVT 527
            LPPWA++  +ERND +  SRS Q K +AVRGVKGTMLPVVRINACVV D GSFVS PR+K R KERH SRS+RS+S+ +DV++SSAESDS SKA N+Q  +GSWK +A INTPKD +CTVD+LQL LGEWYYLDGAGHERGPSSFSELQ LVDQG I K++S FRK+D++WVP+T
Sbjct:  917 LPPWAYACPDERNDGSGGSRSTQSKLAAVRGVKGTMLPVVRINACVVNDHGSFVSEPRSKVRAKERHSSRSARSYSSANDVRRSSAESDSHSKARNNQDSQGSWKSIACINTPKDRLCTVDDLQLQLGEWYYLDGAGHERGPSSFSELQVLVDQGCIQKHTSVFRKFDKVWVPLT 1091          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A067DA80_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000067mg PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.347e-68
Identity = 125/175 (71.43%), Postives = 148/175 (84.57%), Query Frame = -1
Query:    6 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVT 527
            LPPWA++  +ERND +  SRS Q K +AVRGVKGTMLPVVRINACVV D GSFVS PR+K R KERH SRS+RS+S+ +DV++SSAESDS SKA N+Q  +GSWK +A INTPKD +CTVD+LQL LGEWYYLDGAGHERGPSSFSELQ LVDQG I K++S FRK+D++WVP+T
Sbjct:  250 LPPWAYACPDERNDGSGGSRSTQSKLAAVRGVKGTMLPVVRINACVVNDHGSFVSEPRSKVRAKERHSSRSARSYSSANDVRRSSAESDSHSKARNNQDSQGSWKSIACINTPKDRLCTVDDLQLQLGEWYYLDGAGHERGPSSFSELQVLVDQGCIQKHTSVFRKFDKVWVPLT 424          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Match: A0A067DLL2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000067mg PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.434e-68
Identity = 125/175 (71.43%), Postives = 148/175 (84.57%), Query Frame = -1
Query:    6 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWK-VAPINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVT 527
            LPPWA++  +ERND +  SRS Q K +AVRGVKGTMLPVVRINACVV D GSFVS PR+K R KERH SRS+RS+S+ +DV++SSAESDS SKA N+Q  +GSWK +A INTPKD +CTVD+LQL LGEWYYLDGAGHERGPSSFSELQ LVDQG I K++S FRK+D++WVP+T
Sbjct:  868 LPPWAYACPDERNDGSGGSRSTQSKLAAVRGVKGTMLPVVRINACVVNDHGSFVSEPRSKVRAKERHSSRSARSYSSANDVRRSSAESDSHSKARNNQDSQGSWKSIACINTPKDRLCTVDDLQLQLGEWYYLDGAGHERGPSSFSELQVLVDQGCIQKHTSVFRKFDKVWVPLT 1042          
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy Swiss-Prot
Match: ATXR3_ARATH (Histone-lysine N-methyltransferase ATXR3 OS=Arabidopsis thaliana GN=ATXR3 PE=2 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 2.116e-42
Identity = 89/176 (50.57%), Postives = 113/176 (64.20%), Query Frame = -1
Query:    3 LPPWAFSIAEERNDCNDISRSNQIKPSAVRGVKGTMLPVVRINACVVQDQGSFVSAPRTKTRVKEXXXXXXXXXXXXXSDVKKSSAESDSLSKAVNDQRLKGSWKV-APINTPKDHVCTVDELQLHLGEWYYLDGAGHERGPSSFSELQFLVDQGVIPKYSSAFRKYDQMWVPVTS 527
            LP WAFS+ +ERN                RGVK ++L VVR+N+ VV DQ   +  PR K R KER  SR +R    +SD K+ S ES S S A   Q  +G WK    +NTP+D +CTVD+LQLH+G+W+Y DGAG E+GP SFSELQ LV++G I  +SS FRK D++WVPVTS
Sbjct:  868 LPLWAFSVVDERN--------------QTRGVKASLLSVVRLNSLVVNDQVPPIPDPRAKVRSKERCPSRPARPSPASSDSKRESVESHSQSTASTGQDSQGLWKTDTSVNTPRDRLCTVDDLQLHIGDWFYTDGAGQEQGPLSFSELQKLVEKGFIKSHSSVFRKSDKIWVPVTS 1029          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MGL4_GOSAR2.271e-101100.00Putative histone-lysine N-methyltransferase ATXR3-... [more]
A0A0D2R6D4_GOSRA1.454e-10098.29Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EAD1_THECC7.288e-8785.80SET domain protein 2 isoform 2 OS=Theobroma cacao ... [more]
A0A061E4G1_THECC7.317e-8785.80SET domain protein 2 isoform 4 OS=Theobroma cacao ... [more]
A0A061E2H4_THECC9.452e-8785.80SET domain protein 2 isoform 3 OS=Theobroma cacao ... [more]
A0A061E3M9_THECC2.037e-8685.80SET domain protein 2 isoform 1 OS=Theobroma cacao ... [more]
A0A067DMR6_CITSI1.639e-6871.43Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067DAN1_CITSI2.293e-6871.43Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067DA80_CITSI2.347e-6871.43Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067DLL2_CITSI2.434e-6871.43Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001303 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ATXR3_ARATH2.116e-4250.57Histone-lysine N-methyltransferase ATXR3 OS=Arabid... [more]
back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001303 ID=g.arboreum_cottongen_reftransV1_0001303|Name=g.arboreum_cottongen_reftransV1_0001303|organism=Gossypium arboreum|type=contig|length=527bp
GCGGAGGTGACTGGAACCCACATTTGATCATATTTACGAAAAGCACTGCT
ATATTTCGGGATAACTCCTTGATCTACCAAAAACTGAAGTTCAGAGAATG
ATGAAGGTCCCCTTTCATGCCCAGCACCATCAAGGTAGTACCATTCACCC
AAGTGTAACTGCAACTCATCAACAGTACAAACATGGTCTTTAGGAGTATT
AATGGGTGCAACCTTCCATGATCCTTTCAAGCGTTGATCATTAACAGCCT
TTGATAGTGAATCACTTTCTGCCGATGATTTCTTGACATCACTAGTTGTC
GAGTGTGACCGGGAAGATCTTGAACAGTGTCTCTCCTTCACTCGAGTTTT
TGTGCGAGGTGCAGATACAAATGAACCCTGATCCTGAACCACACATGCAT
TTATCCGGACTACTGGAAGCATGGTTCCCTTCACTCCTCTCACAGCAGAA
GGCTTAATTTGATTCGATCTACTAATATCATTGCAATCATTTCTCTCTTC
AGCAATTGAGAAGGCCCAAGGAGGGAG
back to top