g.arboreum_cottongen_reftransV1_0008302, g.arboreum_cottongen_reftransV1_0008302 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0008302
Unique Nameg.arboreum_cottongen_reftransV1_0008302
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1045
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0008302:1..1045 .
Chr11:57639749..57642905 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A0B0MU02_GOSAR (ABC transporter I family member 17 OS=Gossypium arboreum GN=F383_24887 PE=3 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 277/309 (89.64%), Postives = 278/309 (89.97%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS*FTFYNSCYISLFFLCA*DLMLIWFKQCSALQVYLLYLDDHLELGMSTHRADSSLGKVFFVFLISSQPNLNY 1035
            MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQL+                               LQVYLLYLDDHLELGMSTHRADSSLGKVFFVFLISSQPNLNY
Sbjct:   23 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLT-------------------------------LQVYLLYLDDHLELGMSTHRADSSLGKVFFVFLISSQPNLNY 300          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A0D2TBT6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G220300 PE=3 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 1.651e-160
Identity = 233/237 (98.31%), Postives = 234/237 (98.73%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            MKFQIRDLRKVSDAGVPILNGINVGIPKG IVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYG NL GKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKP+ELSEAKHPMAQRFLQLSS
Sbjct:   23 MKFQIRDLRKVSDAGVPILNGINVGIPKGKIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGPNLRGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPNELSEAKHPMAQRFLQLSS 259          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A0D2RR36_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G220300 PE=3 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 2.536e-155
Identity = 229/237 (96.62%), Postives = 230/237 (97.05%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            MKFQIRDLRKVSDAGVPILNGINVGIPKG IVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQ    DNIRYG NL GKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKP+ELSEAKHPMAQRFLQLSS
Sbjct:   23 MKFQIRDLRKVSDAGVPILNGINVGIPKGKIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQ----DNIRYGPNLRGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPNELSEAKHPMAQRFLQLSS 255          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A061FRX8_THECC (Non-intrinsic ABC protein 3 OS=Theobroma cacao GN=TCM_044780 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 3.208e-149
Identity = 218/237 (91.98%), Postives = 227/237 (95.78%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            +KF+IR LRKVS+AGVPILNGI+V IPKGMIVGIIGPSGSGKST+LRALNRLWEP S+TVFLDG DIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYG  L GKKL+D EVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKK+ MTVVMVSHSIKQIQRVADVVCLLVNGEIVE+LKP ELSEAKHPMAQRFLQLSS
Sbjct:   25 VKFEIRGLRKVSEAGVPILNGISVDIPKGMIVGIIGPSGSGKSTMLRALNRLWEPQSNTVFLDGHDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGPRLRGKKLSDEEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKKGMTVVMVSHSIKQIQRVADVVCLLVNGEIVEVLKPGELSEAKHPMAQRFLQLSS 261          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: B9IN00_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0018s13190g PE=3 SV=2)

HSP 1 Score: 407.912 bits (1047), Expect = 5.356e-139
Identity = 203/236 (86.02%), Postives = 216/236 (91.53%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            KF+IR+L KVSDAGVPILNGIN+ IPKGMIVGIIGPSGSGKST+LRALNRLWEPPS TVFLDG D+ DLDVLG RRKVGMLFQLP LF GTVADNIRYG  L GKKLTD EV KLL+LADLDSSF  KT  ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+VKLKK+R +TVV+VSHSIKQIQR+ADVVCLLVNGEIVE+LKP +LSEAKHPMAQRFLQL S
Sbjct:   37 KFRIRNLTKVSDAGVPILNGINMDIPKGMIVGIIGPSGSGKSTVLRALNRLWEPPSGTVFLDGHDVKDLDVLGHRRKVGMLFQLPALFDGTVADNIRYGPQLKGKKLTDDEVYKLLSLADLDSSFYKKTSNELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKQRGLTVVIVSHSIKQIQRIADVVCLLVNGEIVEVLKPDDLSEAKHPMAQRFLQLGS 272          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: V4UUY2_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10009186mg PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.368e-136
Identity = 199/235 (84.68%), Postives = 215/235 (91.49%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLS 816
            KF++R+LRK SD G PIL G+N+ IPKG+I+GIIGPSGSGKSTLLRALNRLWEPPS TVFLDGRDI DLDVL LRRKVGMLFQ+P LF+GTVADNIRYG  L GKKLT+ EV KLL+LADLDSSFLSKTG E+SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+VKLKKK  MT+VMVSHSIKQIQR+ADVVCLLVNGEIVE+LKP  LSEAKHPMA RFLQLS
Sbjct:   35 KFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVADNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLS 269          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A067KI56_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_09883 PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.435e-136
Identity = 201/237 (84.81%), Postives = 218/237 (91.98%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            +KF+I++L K SDAGV ILNGIN+ IPKG+IVGIIGPSGSGKSTLLR+LNRLWEPPS TVFLDGRDI DLDVLGLRR+VGMLFQ+P LF+GTVADNIRYG  L GKKLTD EV KLL LADLDS+F  K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLK+ R MTVVMVSHSIKQIQRVADVVCL+VNGE+VE+LKP+ELSEAKHPMAQRFLQLS+
Sbjct:   36 IKFRIKNLIKKSDAGVTILNGINLDIPKGVIVGIIGPSGSGKSTLLRSLNRLWEPPSGTVFLDGRDIRDLDVLGLRRRVGMLFQVPALFEGTVADNIRYGPQLRGKKLTDHEVHKLLKLADLDSTFHKKNGSELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKENRGMTVVMVSHSIKQIQRVADVVCLVVNGEVVEVLKPNELSEAKHPMAQRFLQLSN 272          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A067F3L2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g022337mg PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.664e-135
Identity = 198/235 (84.26%), Postives = 215/235 (91.49%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLS 816
            KF++R+LRK SD G PIL G+N+ IPKG+I+GIIGPSGSGKSTLLRALNRLWEPPS TVFLDGRDI DLDVL LRRKVGMLFQ+P LF+GTV DNIRYG  L GKKLT+ EV KLL+LADLDSSFL+KTGGE+SVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+VKLKKK  MT+VMVSHSIKQIQR+ADVVCLLVNGEIVE+LKP  LSEAKHPMA RFLQLS
Sbjct:   63 KFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLS 297          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: W9S5Z6_9ROSA (ABC transporter I family member 17 OS=Morus notabilis GN=L484_009212 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.943e-135
Identity = 197/237 (83.12%), Postives = 218/237 (91.98%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            +KF+IR+LRK S++G PILNG++V +PKG+IVGIIGPSGSGKSTLLRALNRLWEPP  +V LDGRDI ++DVL LRRKVGMLFQLPVLF+GTVADNIRYG  L GKKL+D EV KLLTLADLDSSF +K G ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDVIVKLKKK+ MT++MVSHSIKQIQRVADVVCLLVNGEIVE+LKP ELSEAKHPMA RFL+LSS
Sbjct:   28 VKFRIRELRKWSESGDPILNGVSVDVPKGVIVGIIGPSGSGKSTLLRALNRLWEPPPGSVLLDGRDICEIDVLDLRRKVGMLFQLPVLFEGTVADNIRYGPQLRGKKLSDQEVHKLLTLADLDSSFYTKAGSELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKKQGMTILMVSHSIKQIQRVADVVCLLVNGEIVEVLKPDELSEAKHPMALRFLELSS 264          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Match: A0A068TQR2_COFCA (Coffea canephora DH200=94 genomic scaffold, scaffold_2 OS=Coffea canephora GN=GSCOC_T00022297001 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.868e-134
Identity = 196/236 (83.05%), Postives = 214/236 (90.68%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            K QIR+L KVSD  VPILN +NV IP+GMI+G+IGPSGSGKST LRALNRLWEPPS TVFLDG+DI DLDVL LRR+VGMLFQLP LF+GTVADNIRYG  L GKKLTD EV KLLTLADLDS+F  K+GGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDV+VKLKK++ MT+VMVSHSIKQIQR+ADVVCLLV GEIVEILKP +LSEAKHPMA RFL+LS+
Sbjct:   69 KIQIRELSKVSDKSVPILNKVNVDIPRGMIMGVIGPSGSGKSTFLRALNRLWEPPSKTVFLDGQDIGDLDVLALRRRVGMLFQLPALFEGTVADNIRYGPQLKGKKLTDNEVYKLLTLADLDSTFFGKSGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKEKGMTIVMVSHSIKQIQRIADVVCLLVGGEIVEILKPDKLSEAKHPMALRFLELSN 304          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: AB17I_ARATH (ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.202e-130
Identity = 184/236 (77.97%), Postives = 210/236 (88.98%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLSS 819
            K ++ DL +V+D G  IL G+ + IPKGMIVG+IGPSGSGKST LR+LNRLWEPP  TVFLDG DI ++DV+ LRR+VGMLFQLPVLFQGTVADN+RYG NL G+KL+D EV KLL+LADLD+SF  KTG ELSVGQAQRVALARTLANEPEVLLLDEPTSALDPIST+NIEDVIVKLKK+R +T V+VSHSIKQIQ+VAD+VCL+V+GEIVE+LKPSELS A HPMAQRFLQLSS
Sbjct:   28 KIRVHDLTRVADDGSRILKGVTIDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVFLDGEDITNVDVIALRRRVGMLFQLPVLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLADLDASFAKKTGAELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQKVADIVCLVVDGEIVEVLKPSELSHATHPMAQRFLQLSS 263          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: STAR1_ORYSJ (Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 8.002e-116
Identity = 170/236 (72.03%), Postives = 198/236 (83.90%), Query Frame = 1
Query:  112 KFQIRDLRKVSDA-GVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQRFLQLS 816
            K ++R L + S+A G  IL G+++ +P+G++VG+IGPSGSGKSTLLRALNRLWEP    V LDG DI  +DVL LRRKVGMLFQLP +F GTVADN+RYG  L GKKLTD EV  LL+LADLD +  SK   ELSVGQAQRVALARTLAN+PEVLLLDEPTSALDPISTQNIE+ IV+LKK R +T VMVSHS+KQIQR+AD+VCLLV GE+VE+L PSELSEAKHPMA+RFL+LS
Sbjct:  111 KIRVRGLTRRSEARGEEILRGVDLDVPRGVVVGVIGPSGSGKSTLLRALNRLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLQGKKLTDAEVQSLLSLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDEPTSALDPISTQNIEEAIVRLKKTRGLTTVMVSHSVKQIQRIADLVCLLVAGEVVEVLPPSELSEAKHPMARRFLELS 346          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB1_CALS4 (Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.834e-52
Identity = 96/230 (41.74%), Postives = 149/230 (64.78%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSDTVFLDGRDIVDLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVEVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEAKHPMAQ 798
            M+ +++++    D G  IL  +     K  I  ++GPSG+GKST+L+ +NRL EP    +F++G +  ++DV+ LRRK+GM+FQ P LF+GTV +NI  G +L G+K  +++    L    L   +L K    LS G+AQRV++AR LAN PEVLLLDEPTS+LDP ST  IE++I +L ++  M V++V+H+++Q +R+ D    L  GE++E  K  E  E  +P+++
Sbjct:    1 MEIELKNVNYFRD-GKYILKNVYFKFEKNGIYTVVGPSGAGKSTMLKLINRLIEPTEGAIFINGVEYKNIDVILLRRKIGMVFQRPFLFEGTVKENIELGPSLRGEK--NIDALFYLEAVGLSKDYLFKDVNNLSGGEAQRVSIARALANSPEVLLLDEPTSSLDPTSTSIIEELIKRLNREGIM-VILVTHNMEQAKRIGDYTLFLYKGELIEARKTWEFFE--NPVSE 224          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_METTH (Phosphate import ATP-binding protein PstB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pstB PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.583e-47
Identity = 98/227 (43.17%), Postives = 136/227 (59.91%), Query Frame = 1
Query:  109 MKFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWEPPSD-----TVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDV------EVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVE 750
             + ++ DL    D    IL  IN+ IPK  +  +IGPSG GKST +R LNR+ +  S       V+LDG+DI D  +DV+ LR+KVGM+FQ P  F  ++ +N+ YGL + G    D       E  +   L D     L K+   LS GQ QR+ +ART+A EPEV+L+DEP SALDPIST  IED+I KLK     T+++V+H+++Q  RV+      ++GEIVE
Sbjct:    5 YRIEVEDLNVYFDEA-HILKDINLKIPKNTVTALIGPSGCGKSTFIRTLNRMNDVISGFRHEGHVYLDGKDIYDPDMDVVELRKKVGMVFQKPNPFPKSIFENVAYGLRVHGYDDRDFIEERVEESLRAAALWDEVKDKLDKSALGLSGGQQQRLCIARTIAIEPEVILMDEPCSALDPISTTKIEDLIHKLKND--YTIIIVTHNMQQATRVSKYTAFFLHGEIVE 228          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB2_CALS4 (Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 8.936e-47
Identity = 102/225 (45.33%), Postives = 141/225 (62.67%), Query Frame = 1
Query:  112 KFQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE-----PPSDTVFLDGRDIV-DLDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMG---KKLTDVEVSKLLTLADLDSSF---LSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVE 750
            K ++RDL  +    V  L  IN+ +    ++ +IGPSG GKST +R LNR+ +       S TV LDG+DI  ++DV+ LR+KVGM+FQ P  F  TV DN+ YG  + G   K+  +  V K L  A L       L  +   LS GQ QR+ +ARTLA EPEV+L+DEPTSALDPIST  IE++I +LKKK   T+++V+H+++Q  RV+D     +NGE+VE
Sbjct:    3 KIEVRDL-DLFYGEVQALKKINLDVEPNSVLALIGPSGCGKSTFIRTLNRMNDLIEGVKISGTVLLDGKDIYKEVDVIELRKKVGMVFQKPNPFPMTVYDNVAYGPRIHGIRDKRTLNEIVEKSLKAAALWDEVKDRLHHSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPISTMKIEELIEELKKK--YTIIIVTHNMQQAGRVSDYTAFFLNGELVE 224          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_METBU (Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.230e-44
Identity = 94/217 (43.32%), Postives = 132/217 (60.83%), Query Frame = 1
Query:  163 LNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE-----PPSDTVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMG--KKLTDVEVSKLLTLADLDSSFLSKTGGE---LSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSE 777
            L  I++ IP+  +  +IGPSG GKST LR LNR+ +          V +DG +I D  +DV+ LR+ VGM+FQ P  F  ++ DNI YG  + G  K  T+  V K L  A L      + G +   LS GQ QR+ +ARTLA +PE+LL DEP SALDPIST  IED+I++LKK    T+V+V+H+++Q  R++D     ++GEI+E  K   + E
Sbjct:   25 LKDISLDIPEKSVTALIGPSGCGKSTFLRCLNRMNDLVKSCSIEGEVLVDGENIYDKDVDVVDLRKNVGMVFQKPNPFPMSIYDNIAYGPKIHGCSKSETEERVHKALDDAALMGEVQDRLGDQAFSLSGGQQQRLCIARTLAVKPEILLFDEPCSALDPISTSKIEDLILELKKD--YTIVIVTHNMQQAARISDHTAFFLHGEIIEFGKTKHIFE 239          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_METST (Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.818e-44
Identity = 93/210 (44.29%), Postives = 129/210 (61.43%), Query Frame = 1
Query:  160 ILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE-----PPSDTVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTD-----VEVS-KLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVE 750
            +L  IN  I K  +  +IGPSG GKST LR LNR+ +          + LDG+DI D  +DV+ LR+KVGM+FQ    F  ++ DN+ YGL + G+K  D     V+ S K   L D     L K+   LS GQ QR+ +ART+A  PE++L+DEP SALDPIST  +ED+I +LKK    T+V+V+H+++Q  RV+      +NGEI+E
Sbjct:   20 VLKNINTDIEKNSVTALIGPSGCGKSTFLRTLNRMNDLIPIFRKEGQILLDGKDIYDNNVDVVELRKKVGMVFQKANPFPKSIYDNVAYGLRIHGEKDEDKIEKIVKKSLKAAALWDEVEDKLDKSALGLSGGQQQRLCIARTIAVSPEIILMDEPCSALDPISTIKVEDLINQLKKD--YTIVIVTHNMQQATRVSKYTSFFLNGEIIE 227          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_THET2 (Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pstB PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 7.248e-44
Identity = 95/230 (41.30%), Postives = 144/230 (62.61%), Query Frame = 1
Query:  163 LNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE--PP---SDTVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMGKKLTDVE------VSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSE--LSEAKHPMAQRFL 807
            L  I+V  PK  +  IIGPSG GKSTLLR+LNR+ +  P       V  +G +I D  +D + +RR +GM+FQ P  F  T+ +N+ +GL LMG K +++E      + +     ++   F  ++G  LS GQ QR+ +AR +A EP +LL+DEPTSALDPI+TQ IED+I++LK+  R TVV+V+H+++Q  RV+D    +  G +VE   P+E   ++ KHP  + ++
Sbjct:   40 LYDISVRFPKNQVTAIIGPSGCGKSTLLRSLNRMNDLVPGVRVKGEVLYEGVNIYDPRVDPVAVRRHIGMVFQKPNPFPKTIFENVAFGLRLMGVKGSELEDRVVEALKRAALWEEVKDRFKKESGLRLSGGQQQRLCIARAIAVEPPLLLMDEPTSALDPIATQAIEDLILELKE--RYTVVIVTHNMQQAARVSDRTLFMHLGVLVE-EGPTEVIFTKPKHPYTEAYI 266          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_COLP3 (Phosphate import ATP-binding protein PstB OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pstB PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 9.700e-44
Identity = 95/209 (45.45%), Postives = 132/209 (63.16%), Query Frame = 1
Query:  163 LNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE-----PPSDTVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMG---KKLTDVEVSKLLTLADLDSSF---LSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVE 750
            LN I + IPKG +   IGPSG GKSTLLR++NR+ +       S  + L G +I D  +DV  LRRKVGM+FQ P  F  T+ +N+ YGL +MG   ++  D    + L  A L +     L ++   LS GQ QR+ +AR +A +PEVLLLDEPTSALDPIST  IE++I  LKK+   TVV+V+H+++Q  RV+D    +  G+++E
Sbjct:   48 LNNITMSIPKGQVTAFIGPSGCGKSTLLRSINRMNDLVDNCHISGEINLHGSNIYDKHVDVAELRRKVGMVFQRPNPFPKTIYENVVYGLRIMGENNRRRLDEAAEQSLRSAALWNEVKDRLHESALGLSGGQQQRLVIARAIAIQPEVLLLDEPTSALDPISTLTIEELINDLKKQ--FTVVIVTHNMQQAARVSDQTAFMYMGDLIE 254          
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Match: PSTB_ARCFU (Phosphate import ATP-binding protein PstB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pstB PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.256e-43
Identity = 99/245 (40.41%), Postives = 145/245 (59.18%), Query Frame = 1
Query:  115 FQIRDLRKVSDAGVPILNGINVGIPKGMIVGIIGPSGSGKSTLLRALNRLWE-----PPSDTVFLDGRDIVD--LDVLGLRRKVGMLFQLPVLFQGTVADNIRYGLNLMG----KKLTDV--EVSKLLTLADLDSSFLSKTGGELSVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVIVKLKKKRRMTVVMVSHSIKQIQRVADVVCLLVNGEIVEILKPSELSEA-KHPMAQRFL 807
            F IR+        V I N +N+ I +  +  IIGPSG GKSTLLR+LNRL E          V  DG++I D  +D + LRR++GM+FQ P  F  ++ DN+ YG  + G    ++L ++  E  K   L D     LS +   LS GQ QR+ +AR +A  PEV+L DEPTSALDPI+   IE+++V+LKK    TVV+V+H+I+Q  R++D V     GE+VE  K +++ E  +  + +++L
Sbjct:    5 FDIRNFSVYYGNKVGIRN-VNLEIYRNKVTAIIGPSGCGKSTLLRSLNRLIELVDGVRIEGEVIFDGKNIYDDGVDAVELRRRIGMVFQHPNPFPKSIFDNVAYGPRVHGIKDKERLKEIVEESLKKAALWDEVKDRLSDSALGLSGGQQQRLCIARAIATNPEVILFDEPTSALDPIAAAKIEELMVELKKN--YTVVVVTHNIQQAARISDYVAFFWMGELVEYGKTAKVFEKPEKELTEKYL 246          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MU02_GOSAR0.000e+089.64ABC transporter I family member 17 OS=Gossypium ar... [more]
A0A0D2TBT6_GOSRA1.651e-16098.31Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RR36_GOSRA2.536e-15596.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FRX8_THECC3.208e-14991.98Non-intrinsic ABC protein 3 OS=Theobroma cacao GN=... [more]
B9IN00_POPTR5.356e-13986.02Uncharacterized protein OS=Populus trichocarpa GN=... [more]
V4UUY2_9ROSI1.368e-13684.68Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A067KI56_JATCU1.435e-13684.81Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A067F3L2_CITSI1.664e-13584.26Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
W9S5Z6_9ROSA7.943e-13583.12ABC transporter I family member 17 OS=Morus notabi... [more]
A0A068TQR2_COFCA1.868e-13483.05Coffea canephora DH200=94 genomic scaffold, scaffo... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0008302 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
AB17I_ARATH1.202e-13077.97ABC transporter I family member 17 OS=Arabidopsis ... [more]
STAR1_ORYSJ8.002e-11672.03Protein STAR1 OS=Oryza sativa subsp. japonica GN=S... [more]
PSTB1_CALS42.834e-5241.74Phosphate import ATP-binding protein PstB 1 OS=Cal... [more]
PSTB_METTH3.583e-4743.17Phosphate import ATP-binding protein PstB OS=Metha... [more]
PSTB2_CALS48.936e-4745.33Phosphate import ATP-binding protein PstB 2 OS=Cal... [more]
PSTB_METBU2.230e-4443.32Phosphate import ATP-binding protein PstB OS=Metha... [more]
PSTB_METST5.818e-4444.29Phosphate import ATP-binding protein PstB OS=Metha... [more]
PSTB_THET27.248e-4441.30Phosphate import ATP-binding protein PstB OS=Therm... [more]
PSTB_COLP39.700e-4445.45Phosphate import ATP-binding protein PstB OS=Colwe... [more]
PSTB_ARCFU1.256e-4340.41Phosphate import ATP-binding protein PstB OS=Archa... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 50..233
e-value: 3.8E-17
score: 73.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 25..254
e-value: 8.3E-71
score: 237.7
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 26..246
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 41..184
e-value: 1.4E-31
score: 109.7
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 25..256
score: 24.71
NoneNo IPR availablePANTHERPTHR24220FAMILY NOT NAMEDcoord: 26..255
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 156..170

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0008302 ID=g.arboreum_cottongen_reftransV1_0008302|Name=g.arboreum_cottongen_reftransV1_0008302|organism=Gossypium arboreum|type=contig|length=1045bp
ACAGAAAAATTCCAAGTAAATAAAAAAGCTAAACAACAAAATATGTCTGC
AGAGCATTTGCTGTTAACCGTTGACGATGTCGATGATCATAATCATGATG
GTGGTGTGATGAAATTCCAGATTCGTGATTTGAGGAAAGTATCGGATGCG
GGCGTTCCTATACTAAACGGTATCAACGTCGGTATCCCTAAAGGGATGAT
CGTCGGGATCATCGGACCAAGCGGGAGTGGGAAATCGACGCTGCTTAGAG
CTCTGAATCGCCTGTGGGAGCCTCCATCCGATACGGTGTTCCTTGACGGC
CGTGATATTGTTGACCTTGATGTACTTGGACTTCGCCGTAAAGTCGGCAT
GCTTTTCCAGCTCCCCGTTTTGTTTCAAGGCACTGTTGCAGATAATATTC
GATATGGACTAAACTTGATGGGAAAGAAGTTAACTGATGTTGAAGTTTCC
AAGTTGCTAACGCTGGCAGACCTTGATTCCTCCTTTCTCAGTAAAACTGG
TGGTGAATTATCTGTTGGTCAAGCTCAAAGAGTTGCACTTGCTCGGACAC
TTGCTAACGAACCTGAGGTTTTGCTGCTGGATGAGCCAACAAGTGCCTTG
GATCCGATTTCGACACAAAACATAGAGGATGTGATAGTGAAGCTTAAGAA
GAAAAGGAGAATGACAGTTGTAATGGTTTCCCACAGCATCAAGCAAATCC
AAAGGGTTGCAGATGTTGTTTGCCTTCTTGTGAATGGTGAAATTGTTGAG
ATTTTGAAGCCTAGTGAACTCTCTGAAGCCAAGCATCCCATGGCACAAAG
GTTTCTTCAGCTAAGTTCTTAATTTACTTTCTATAATAGTTGTTATATTT
CCCTTTTTTTTCTTTGTGCTTAGGATTTGATGTTAATTTGGTTTAAACAA
TGTTCAGCATTGCAAGTTTATTTGTTGTATCTTGATGATCACCTTGAGCT
CGGCATGTCCACTCACCGGGCAGATAGCTCGCTTGGAAAGGTTTTCTTTG
TTTTTTTAATTTCGAGTCAACCCAACTTGAATTACTGACTAAAAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity