g.arboreum_cottongen_reftransV1_0006676, g.arboreum_cottongen_reftransV1_0006676 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0006676
Unique Nameg.arboreum_cottongen_reftransV1_0006676
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length589
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0006676:1..589 .
Chr1:49536637..49537643 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0B0MXZ7_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_33282 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.750e-82
Identity = 172/172 (100.00%), Postives = 172/172 (100.00%), Query Frame = 1
Query:   73 CTFENIVVLAVQGPAXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            CTFENIVVLAVQGPASSPISTPISTSMAAFSPAGIQLGGEEHKKMDPTKKMLLALILAGSSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK
Sbjct:   15 CTFENIVVLAVQGPASSPISTPISTSMAAFSPAGIQLGGEEHKKMDPTKKMLLALILAGSSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 186          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0D2LUC0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G036400 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.290e-77
Identity = 165/172 (95.93%), Postives = 166/172 (96.51%), Query Frame = 1
Query:   73 CTFENIVVLAVQGPAXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            C  ENIV LAVQGPASSPISTPIS SMAAFSPAGIQLGGEEHKKMDPTKKMLLALILA SSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGK KSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKA+FNDGSYAAVKKLDCASQDAEK
Sbjct:   15 CALENIV-LAVQGPASSPISTPISASMAAFSPAGIQLGGEEHKKMDPTKKMLLALILACSSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGKFKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAEFNDGSYAAVKKLDCASQDAEK 185          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0D2PU78_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G036400 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 8.243e-77
Identity = 165/172 (95.93%), Postives = 166/172 (96.51%), Query Frame = 1
Query:   73 CTFENIVVLAVQGPAXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            C  ENIV LAVQGPASSPISTPIS SMAAFSPAGIQLGGEEHKKMDPTKKMLLALILA SSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGK KSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKA+FNDGSYAAVKKLDCASQDAEK
Sbjct:   15 CALENIV-LAVQGPASSPISTPISASMAAFSPAGIQLGGEEHKKMDPTKKMLLALILACSSLGAIISSLFCLWIYYRKNSSKSSKNGAKSSDGEKGNGLAPYLGKFKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAEFNDGSYAAVKKLDCASQDAEK 185          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A061GQG8_THECC (Kinase superfamily protein OS=Theobroma cacao GN=TCM_036937 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.946e-54
Identity = 122/146 (83.56%), Postives = 128/146 (87.67%), Query Frame = 1
Query:  151 MAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            M AFSP GIQ+G EEHKKMDP KKM +ALILA SSLGAIISSL CLWIY RKNS KS KN AKSSD EKGN LAP+ GK KS+RTVSKEG ASFMDYKILEKAT+KFH GNILGEGGFGCVYKAQF+DGSYAAVKKLDCAS DAEK
Sbjct:   40 MTAFSP-GIQVGSEEHKKMDPPKKMFIALILACSSLGAIISSLCCLWIYCRKNSPKSKKNDAKSSDAEKGNRLAPFFGKFKSIRTVSKEGDASFMDYKILEKATSKFHQGNILGEGGFGCVYKAQFDDGSYAAVKKLDCASHDAEK 184          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0B0PTB8_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_33408 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.030e-51
Identity = 123/180 (68.33%), Postives = 146/180 (81.11%), Query Frame = 1
Query:   70 VCTFENIVVLAVQGP-------AXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            + T EN++V+AVQGP        SSP S+PIS S++AFSP G QLG EEH K DP  KML+A+I+   SLGAII SLFCLWIYYRKNS KS+ N AK+SD EKG+GLAP+ GK K+ RTVSKEG ASFM+YK LEK+TNKFH GNILGEGGFGCVYKAQF+ GS+AAVKKL+CA+QDA++
Sbjct:   15 IFTHENMIVVAVQGPLASSLSPVSSPFSSPISASVSAFSP-GFQLGSEEHTKKDPPNKMLIAIIIGCCSLGAIICSLFCLWIYYRKNSPKSTTNDAKNSDAEKGSGLAPFFGKFKATRTVSKEGSASFMEYKTLEKSTNKFHQGNILGEGGFGCVYKAQFDVGSFAAVKKLNCANQDAKR 193          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0D2UH45_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G060300 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.692e-50
Identity = 122/180 (67.78%), Postives = 144/180 (80.00%), Query Frame = 1
Query:   70 VCTFENIVVLAVQGP-------AXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            + T EN++V+AV GP        SSP S+PIS SM+AFSP G QLG EEH K DP  KML+A+I+   SLGAII SLFCLWIYYRKNS KS+ N AK+SD EKG+GLAP+ GK K+ RTVSKEG ASFM+YK LEK+TNKFH  NILGEGGFGCVYKAQF+ GS+AAVKKL+CA+QDA++
Sbjct:   15 IFTHENMIVVAVPGPLASSLSPVSSPFSSPISASMSAFSP-GFQLGSEEHTKKDPPNKMLIAIIIGCCSLGAIICSLFCLWIYYRKNSHKSTTNDAKNSDAEKGSGLAPFFGKFKATRTVSKEGSASFMEYKTLEKSTNKFHQCNILGEGGFGCVYKAQFDVGSFAAVKKLNCANQDAKR 193          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0D2RUY2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G060300 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.701e-50
Identity = 122/180 (67.78%), Postives = 144/180 (80.00%), Query Frame = 1
Query:   70 VCTFENIVVLAVQGP-------AXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            + T EN++V+AV GP        SSP S+PIS SM+AFSP G QLG EEH K DP  KML+A+I+   SLGAII SLFCLWIYYRKNS KS+ N AK+SD EKG+GLAP+ GK K+ RTVSKEG ASFM+YK LEK+TNKFH  NILGEGGFGCVYKAQF+ GS+AAVKKL+CA+QDA++
Sbjct:   15 IFTHENMIVVAVPGPLASSLSPVSSPFSSPISASMSAFSP-GFQLGSEEHTKKDPPNKMLIAIIIGCCSLGAIICSLFCLWIYYRKNSHKSTTNDAKNSDAEKGSGLAPFFGKFKATRTVSKEGSASFMEYKTLEKSTNKFHQCNILGEGGFGCVYKAQFDVGSFAAVKKLNCANQDAKR 193          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A0D2TEH0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G060300 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.352e-49
Identity = 122/180 (67.78%), Postives = 144/180 (80.00%), Query Frame = 1
Query:   70 VCTFENIVVLAVQGP-------AXXXXXXXXXXXMAAFSPAGIQLGGEEHKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            + T EN++V+AV GP        SSP S+PIS SM+AFSP G QLG EEH K DP  KML+A+I+   SLGAII SLFCLWIYYRKNS KS+ N AK+SD EKG+GLAP+ GK K+ RTVSKEG ASFM+YK LEK+TNKFH  NILGEGGFGCVYKAQF+ GS+AAVKKL+CA+QDA++
Sbjct:   15 IFTHENMIVVAVPGPLASSLSPVSSPFSSPISASMSAFSP-GFQLGSEEHTKKDPPNKMLIAIIIGCCSLGAIICSLFCLWIYYRKNSHKSTTNDAKNSDAEKGSGLAPFFGKFKATRTVSKEGSASFMEYKTLEKSTNKFHQCNILGEGGFGCVYKAQFDVGSFAAVKKLNCANQDAKR 193          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A067E7A9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012975mg PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.181e-26
Identity = 88/147 (59.86%), Postives = 109/147 (74.15%), Query Frame = 1
Query:  151 MAAFSPAGIQLGGEE--HKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYA-SFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDA 582
            MAAFSP GIQ+G E+  H  MD   K+L+ALI+A S+L  II +L CLW+Y+ K S KSS   AKS D E G  L+ +LGK  S+R VSK+G A SF++YK+LEKAT+ FH  NILGEGGFGCVYKA+ +D  + AVKKLDCA+QDA
Sbjct:   45 MAAFSP-GIQMGSEDPHHHHMDAHHKLLIALIIACSALCLIILALLCLWLYHLKYSFKSSNKNAKSKDSENGVVLSSFLGKFTSVRMVSKKGSAISFIEYKLLEKATDSFHESNILGEGGFGCVYKAKLDDNLHVAVKKLDCATQDA 190          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Match: A0A067E6D9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012975mg PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.474e-26
Identity = 88/147 (59.86%), Postives = 109/147 (74.15%), Query Frame = 1
Query:  151 MAAFSPAGIQLGGEE--HKKMDPTKKMXXXXXXXXXXXXXXXXXXFCLWIYYRXXXXXXXXXXXXXXDGEKGNGLAPYLGKLKSMRTVSKEGYA-SFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDA 582
            MAAFSP GIQ+G E+  H  MD   K+L+ALI+A S+L  II +L CLW+Y+ K S KSS   AKS D E G  L+ +LGK  S+R VSK+G A SF++YK+LEKAT+ FH  NILGEGGFGCVYKA+ +D  + AVKKLDCA+QDA
Sbjct:   45 MAAFSP-GIQMGSEDPHHHHMDAHHKLLIALIIACSALCLIILALLCLWLYHLKYSFKSSNKNAKSKDSENGVVLSSFLGKFTSVRMVSKKGSAISFIEYKLLEKATDSFHESNILGEGGFGCVYKAKLDDNLHVAVKKLDCATQDA 190          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: Y1864_ARATH (Probable receptor-like protein kinase At1g80640 OS=Arabidopsis thaliana GN=At1g80640 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.039e-8
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  346 DGEKGNGLAPYLGKLKSMRTVSKEGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLD 564
            D  K     P + K+ S+R    +G     +Y++LE ATNKF   N+L  GG GC+Y+A  ++ S   VKKLD
Sbjct:  112 DSVKSVTTKPTVHKIDSVR----KGTIPVYEYQLLESATNKFSDSNVLSRGGRGCLYRACLDEKSSVTVKKLD 180          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: Y1497_ARATH (Probable receptor-like protein kinase At1g49730 OS=Arabidopsis thaliana GN=At1g49730 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.085e-8
Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  439 YKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            YK +  ATN F+   ++G+GGFG VYKA+FNDG  AAVKK++  S+ AE+
Sbjct:  319 YKEMTNATNDFN--TVIGQGGFGTVYKAEFNDGLIAAVKKMNKVSEQAEQ 366          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: PERK3_ARATH (Proline-rich receptor-like protein kinase PERK3 OS=Arabidopsis thaliana GN=PERK3 PE=2 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 3.839e-8
Identity = 28/56 (50.00%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  421 YASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            + S   Y  L +ATNKF   N+LGEGGFG VYK   N+G+  AVK+L   S   EK
Sbjct:  167 HQSTFTYGELARATNKFSEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEK 222          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 4.197e-8
Identity = 28/48 (58.33%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  448 LEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKL--DCASQDAE 585
            L K+TN F   NI+G GGFG VYKA F DGS AAVK+L  DC   + E
Sbjct:  747 LLKSTNNFSQANIIGCGGFGLVYKANFPDGSKAAVKRLSGDCGQMERE 794          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: TMK4_ARATH (Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 6.299e-8
Identity = 23/53 (43.40%), Postives = 35/53 (66.04%), Query Frame = 1
Query:  415 EGYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCAS 573
            EG +  +  ++L + TN F   NILG GGFG VY  + +DG+  AVK+++CA+
Sbjct:  560 EGGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECAA 612          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 8.268e-8
Identity = 24/42 (57.14%), Postives = 31/42 (73.81%), Query Frame = 1
Query:  436 DYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKL 561
            D+K +E ATNKF   N LGEGGFG VYK + ++G+  AVK+L
Sbjct:  339 DFKTIEAATNKFSTSNKLGEGGFGAVYKGKLSNGTDVAVKRL 380          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: CRK15_ARATH (Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana GN=CRK15 PE=2 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 9.854e-8
Identity = 23/47 (48.94%), Postives = 34/47 (72.34%), Query Frame = 1
Query:  433 MDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCAS 573
            +DY+++  ATNKF   N +G+GGFG VYK  F++G+  AVK+L  +S
Sbjct:  325 LDYRMIRAATNKFSENNKIGQGGFGEVYKGTFSNGTEVAVKRLSKSS 371          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: Y4345_ARATH (Probable receptor-like serine/threonine-protein kinase At4g34500 OS=Arabidopsis thaliana GN=At4g34500 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.413e-7
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  418 GYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCASQDAEK 588
            G+  +   K LE AT  F   N++GEGG+G VY+A F+DGS AAVK L      AEK
Sbjct:  128 GWGKWYSLKDLEIATRGFSDDNMIGEGGYGVVYRADFSDGSVAAVKNLLNNKGQAEK 184          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: NIK3_ARATH (Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis thaliana GN=NIK3 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.537e-7
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  418 GYASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKL-DC 567
            G+     +K L  ATN F+  NILG GG+G VYK   NDG+  AVK+L DC
Sbjct:  284 GHLKRYTFKELRSATNHFNSKNILGRGGYGIVYKGHLNDGTLVAVKRLKDC 334          
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Match: CRK22_ARATH (Cysteine-rich receptor-like protein kinase 22 OS=Arabidopsis thaliana GN=CRK22 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.720e-7
Identity = 27/52 (51.92%), Postives = 36/52 (69.23%), Query Frame = 1
Query:  436 DYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAVKKLDCAS-QDAEK 588
            ++K +E ATNKF   N LGEG FG VYK +F++G+  AVK+L   S QD +K
Sbjct:  342 EFKTIEAATNKFSKSNKLGEGRFGEVYKGKFSNGTEVAVKRLSKVSGQDTKK 393          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MXZ7_GOSAR1.750e-82100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2LUC0_GOSRA7.290e-7795.93Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PU78_GOSRA8.243e-7795.93Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GQG8_THECC3.946e-5483.56Kinase superfamily protein OS=Theobroma cacao GN=T... [more]
A0A0B0PTB8_GOSAR2.030e-5168.33Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2UH45_GOSRA5.692e-5067.78Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RUY2_GOSRA5.701e-5067.78Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2TEH0_GOSRA1.352e-4967.78Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067E7A9_CITSI1.181e-2659.86Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067E6D9_CITSI1.474e-2659.86Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0006676 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
Y1864_ARATH1.039e-839.73Probable receptor-like protein kinase At1g80640 OS... [more]
Y1497_ARATH1.085e-854.00Probable receptor-like protein kinase At1g49730 OS... [more]
PERK3_ARATH3.839e-850.00Proline-rich receptor-like protein kinase PERK3 OS... [more]
PSKR2_ARATH4.197e-858.33Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
TMK4_ARATH6.299e-843.40Receptor-like kinase TMK4 OS=Arabidopsis thaliana ... [more]
CRK11_ARATH8.268e-857.14Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
CRK15_ARATH9.854e-848.94Cysteine-rich receptor-like protein kinase 15 OS=A... [more]
Y4345_ARATH1.413e-749.12Probable receptor-like serine/threonine-protein ki... [more]
NIK3_ARATH1.537e-750.98Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis th... [more]
CRK22_ARATH1.720e-751.92Cysteine-rich receptor-like protein kinase 22 OS=A... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013320Concanavalin A-like lectin/glucanase domainGENE3D2.60.120.200coord: 59..167
e-value: 7.2E-10
score: 38.3
NoneNo IPR availableGENE3D3.30.200.20coord: 168..191
e-value: 6.2E-6
score: 25.9
NoneNo IPR availablePANTHERPTHR27001:SF62PROTEIN KINASE FAMILY PROTEIN-RELATEDcoord: 35..103
coord: 121..193
NoneNo IPR availablePANTHERPTHR27001FAMILY NOT NAMEDcoord: 35..103
coord: 121..193
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 98..193
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 24..31
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 72..97
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 12..23
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..31
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..11
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 32..71
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..31
score: 0.712
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..31
score: 0.477
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 160..183
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 154..193
score: 8.556
IPR011009Protein kinase-like domainSUPERFAMILY56112Protein kinase-like (PK-like)coord: 133..185

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0006676 ID=g.arboreum_cottongen_reftransV1_0006676|Name=g.arboreum_cottongen_reftransV1_0006676|organism=Gossypium arboreum|type=contig|length=589bp
AAAGAATCATTGTTTGAAAGAAACAAAGGGATGAAGAAGAAGCTTGTGCT
GCATCTGCTTCTTTTCCTTGTTTGTACTTTTGAAAACATTGTTGTTTTGG
CCGTACAAGGCCCTGCTTCATCACCCATTTCTACTCCCATCTCTACTTCA
ATGGCTGCCTTCTCTCCAGCTGGGATTCAACTTGGAGGTGAGGAGCACAA
GAAAATGGATCCAACCAAGAAAATGTTATTAGCTCTCATTCTTGCTGGCT
CTTCATTGGGTGCAATTATCTCTTCCTTGTTCTGTTTATGGATTTATTAC
AGGAAGAATTCAAGCAAATCCTCTAAAAATGGTGCTAAGAGCTCAGATGG
TGAAAAAGGGAATGGTTTGGCACCATATTTGGGTAAACTCAAGTCTATGA
GGACGGTTTCCAAAGAGGGTTATGCTTCGTTTATGGACTATAAGATACTT
GAAAAAGCTACAAACAAGTTCCATCATGGTAATATTCTGGGTGAGGGTGG
ATTTGGATGTGTTTACAAGGCTCAATTCAATGATGGTTCTTATGCTGCTG
TTAAGAAGTTGGACTGTGCAAGCCAAGATGCTGAAAAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR013320ConA-like_dom_sf
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation