g.arboreum_cottongen_reftransV1_0017713, g.arboreum_cottongen_reftransV1_0017713 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0017713
Unique Nameg.arboreum_cottongen_reftransV1_0017713
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length742
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0017713:1..742 .
Chr11:8475860..8476601 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A0B0N7K5_GOSAR (Protein SCARECROW-like protein OS=Gossypium arboreum GN=F383_05220 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 9.099e-94
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = -3
Query:    3 MLMAACDLVGENGGINGRNSNDESQMRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRNXXXXXXXXXXXXXXXXXXXSLAPI 506
            MLMAACDLVGENGGINGRNSNDESQMRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRNTAVASAAVTATSVNTTVPVSLAPI
Sbjct:    1 MLMAACDLVGENGGINGRNSNDESQMRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRNTAVASAAVTATSVNTTVPVSLAPI 168          
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A0D2T3D3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G236200 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 2.884e-91
Identity = 163/168 (97.02%), Postives = 166/168 (98.81%), Query Frame = -3
Query:    3 MLMAACDLVGENGGINGRNSNDESQMRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRNXXXXXXXXXXXXXXXXXXXSLAPI 506
            MLMAACDLVGENGGINGRNSNDES MRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSF+AATGASNNPNPLFNYSTMNMDNVNT+VPSANFAALTSAGPAFLSTTASNFSCVDAVGTN+PQPPAVCGFSGLPLFPPTERNRNTAV SAAVTATSVNTTVPVSLAPI
Sbjct:    1 MLMAACDLVGENGGINGRNSNDESPMRSTMRKRMASEVADYHRFPRRTQFVSDNNMACSFMAATGASNNPNPLFNYSTMNMDNVNTVVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNTPQPPAVCGFSGLPLFPPTERNRNTAVDSAAVTATSVNTTVPVSLAPI 168          
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A061EF07_THECC (GRAS family transcription factor isoform 1 OS=Theobroma cacao GN=TCM_017746 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.023e-51
Identity = 97/160 (60.62%), Postives = 116/160 (72.50%), Query Frame = -3
Query:   75 NSLMLMAACDLVGENGG-INGRNSNDESQMRST----------MRKRMASEVADYHRFPRRT--QFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRN 515
            ++L+ MAACDLVGENG  ING +++ ES + S           MRKRMASE+ADYHRFPRR+        NM CSF+AA   +NNPNPL NYSTMNM+   TI+PSAN  A+TS GPAFL TT SN +C+D + T +P PPAVCGFSGLPLFPPT+RNRN
Sbjct:   14 DTLLFMAACDLVGENGSEINGCSNSRESPVTSASNSSTSEGKMMRKRMASEIADYHRFPRRSLPSHPPSENMGCSFLAAATTANNPNPLLNYSTMNMNT--TIIPSANLTAVTSGGPAFLCTTTSNITCIDNLSTTNPPPPAVCGFSGLPLFPPTDRNRN 171          
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A061EDZ9_THECC (GRAS family transcription factor isoform 3 OS=Theobroma cacao GN=TCM_017746 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.339e-49
Identity = 96/155 (61.94%), Postives = 112/155 (72.26%), Query Frame = -3
Query:   75 MAACDLVGENGG-INGRNSNDESQMRST----------MRKRMASEVADYHRFPRRT--QFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRN 500
            MAACDLVGENG  ING +++ ES + S           MRKRMASE+ADYHRFPRR+        NM CSF+AA   +NNPNPL NYSTMNM+   TI+PSAN  A+TS GPAFL TT SN +C+D + T +P PPAVCGFSGLPLFPPT+RNRN
Sbjct:    1 MAACDLVGENGSEINGCSNSRESPVTSASNSSTSEGKMMRKRMASEIADYHRFPRRSLPSHPPSENMGCSFLAAATTANNPNPLLNYSTMNMNT--TIIPSANLTAVTSGGPAFLCTTTSNITCIDNLSTTNPPPPAVCGFSGLPLFPPTDRNRN 153          
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A061ELM0_THECC (GRAS family transcription factor isoform 2 OS=Theobroma cacao GN=TCM_017746 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.089e-49
Identity = 96/155 (61.94%), Postives = 112/155 (72.26%), Query Frame = -3
Query:   75 MAACDLVGENGG-INGRNSNDESQMRST----------MRKRMASEVADYHRFPRRT--QFVSDNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRN 500
            MAACDLVGENG  ING +++ ES + S           MRKRMASE+ADYHRFPRR+        NM CSF+AA   +NNPNPL NYSTMNM+   TI+PSAN  A+TS GPAFL TT SN +C+D + T +P PPAVCGFSGLPLFPPT+RNRN
Sbjct:    1 MAACDLVGENGSEINGCSNSRESPVTSASNSSTSEGKMMRKRMASEIADYHRFPRRSLPSHPPSENMGCSFLAAATTANNPNPLLNYSTMNMNT--TIIPSANLTAVTSGGPAFLCTTTSNITCIDNLSTTNPPPPAVCGFSGLPLFPPTDRNRN 153          
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Match: A0A0D2R6S0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G001300 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 7.399e-36
Identity = 86/156 (55.13%), Postives = 101/156 (64.74%), Query Frame = -3
Query:   75 MAACDLVGENGG-INGRNS---------NDESQMRSTMRKRMASEVADYHRFPRRTQFVS----DNNMACSFIAATGASNNPNPLFNYSTMNMDNVNTIVPSANFAALTSAGPAFLSTTASNFSCVDAVGTNSPQPPAVCGFSGLPLFPPTERNRN 500
            M A DLV EN    NG +S         N+ S  +  MRKRMASE+AD  RFPRRT  VS    DNN  CSF+ A  +SN   PL N+S + M+    I PSANF A+TS GPA LSTT S F+C+D + T+ P PPAVCGFSGLPLFPPT+RNRN
Sbjct:    1 MDASDLVDENHSETNGSSSSRGHPVAVANNTSDGK-MMRKRMASEIADNQRFPRRT-LVSEPEPDNNTVCSFLPAPASSN---PLLNHSNIKMNTA--IFPSANFIAVTSGGPAVLSTTTSTFTCIDTISTSKPHPPAVCGFSGLPLFPPTDRNRN 149          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 6
Match NameE-valueIdentityDescription
A0A0B0N7K5_GOSAR9.099e-94100.00Protein SCARECROW-like protein OS=Gossypium arbore... [more]
A0A0D2T3D3_GOSRA2.884e-9197.02Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EF07_THECC8.023e-5160.63GRAS family transcription factor isoform 1 OS=Theo... [more]
A0A061EDZ9_THECC1.339e-4961.94GRAS family transcription factor isoform 3 OS=Theo... [more]
A0A061ELM0_THECC2.089e-4961.94GRAS family transcription factor isoform 2 OS=Theo... [more]
A0A0D2R6S0_GOSRA7.399e-3655.13Uncharacterized protein OS=Gossypium raimondii GN=... [more]
back to top
BLAST of g.arboreum_cottongen_reftransV1_0017713 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0017713 ID=g.arboreum_cottongen_reftransV1_0017713|Name=g.arboreum_cottongen_reftransV1_0017713|organism=Gossypium arboreum|type=contig|length=742bp
GAGATCGGAGCTAAAGAGACAGGGACGGTAGTATTCACGGACGTGGCAGT
AACGGCGGCGGAAGCGACGGCGGTATTCCGATTCCTCTCCGTTGGTGGAA
ACAAAGGCAAACCCGAAAACCCACACACGGCAGGCGGCTGGGGACTATTA
GTACCCACGGCGTCGACGCAAGAAAAGTTAGAAGCAGTCGTAGATAAAAA
AGCAGGCCCGGCTGACGTCAAGGCGGCGAAATTCGCAGAAGGGACAATGG
TGTTAACATTATCCATATTCATAGTGGAGTAGTTGAATAGCGGATTAGGG
TTATTACTAGCACCGGTGGCCGCTATGAAAGAACAAGCCATGTTGTTATC
AGAAACAAACTGAGTTCGACGAGGAAACCTGTGGTAATCAGCCACCTCGG
AAGCCATCCTCTTCCTCATCGTGCTCCTCATTTGGCTTTCATCGTTGCTG
TTTCTACCATTAATACCACCATTTTCACCTACCAAATCACAAGCGGCCAT
TAACATCAATGAATTTCACTCCTCTTCATAAAGCTAACAAAAGCAAGCAG
TAATAATACACCGTTCTGCAACAAGTACACTATATTTATGACAAAATGGG
GTTGTGAAGGAGAAAGGTCGTCCAAGAAGAAAACGGTAGGAGAATTGGGA
CAACAACGGCTTTGGGATTCCACTCACTTCACTCACTGTAATAGCTAGGC
TAGCACGACATTTTATGCTAAACCCAGAAAAAATAAAGAAAG
back to top