g.arboreum_cottongen_reftransV1_0016633, g.arboreum_cottongen_reftransV1_0016633 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0016633
Unique Nameg.arboreum_cottongen_reftransV1_0016633
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length930
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0016633:1..930 .
Chr1:129885010..129885939 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: A0A0B0MYW9_GOSAR (Epidermal growth factor receptor OS=Gossypium arboreum GN=F383_32069 PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.346e-103
Identity = 194/194 (100.00%), Postives = 194/194 (100.00%), Query Frame = 3
Query:    3 ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE 584
            ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQRPGSSPSFSPGRGRGPGYRGSSGPGLGRSAGRGQGFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE
Sbjct:  139 ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQRPGSSPSFSPGRGRGPGYRGSSGPGLGRSAGRGQGFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE 332          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: A0A0D2QT54_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G346500 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.553e-99
Identity = 186/194 (95.88%), Postives = 188/194 (96.91%), Query Frame = 3
Query:    3 ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE 584
            ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYG LPNPG SPADGR+FNYGAARPQMFGRNPILDQRPG SP+FSPGRGRGPGYRGS GPGLGRSAGRGQGFHG SSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLG PGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE
Sbjct:  138 ATEHYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGNLPNPGISPADGRNFNYGAARPQMFGRNPILDQRPGGSPNFSPGRGRGPGYRGSGGPGLGRSAGRGQGFHGRSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGTPGTSNSSGIKRAKVSEASSKQSLAEYLAASFNKAVEGTE 331          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: A0A061FFF7_THECC (Hydroxyproline-rich glycoprotein family protein, putative isoform 2 OS=Theobroma cacao GN=TCM_034520 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.259e-49
Identity = 123/200 (61.50%), Postives = 138/200 (69.00%), Query Frame = 3
Query:   12 HYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSN-----SSGIKRAKVSEASSK----QSLAEYLAASFNKAVEGTE 584
            +Y+  SDGSP GMFG P  HPGT  R WNPSN S Y   P PGFSPAD     YG  RPQ FG  P+     G S   S GRGRG GY GS   G+GRS GRG GFHGHSSASN+M+GPE ++DESML+DPWQHLKP+ WRR+EAGMDSL  P +SN     S   K+ KVSEAS+K     SLAEYLAASFNKAVE T+
Sbjct:  147 YYSSASDGSPGGMFGTPLMHPGTTPRFWNPSNASRYSNSPTPGFSPAD---IPYGRGRPQQFGNYPLPSPGHGGSLGLSSGRGRGRGYGGSITHGIGRSGGRGLGFHGHSSASNRMMGPESFYDESMLEDPWQHLKPVLWRRREAGMDSLSNPDSSNSWFPKSISAKKVKVSEASNKFNSQLSLAEYLAASFNKAVEDTK 343          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: A0A061FEH0_THECC (Hydroxyproline-rich glycoprotein family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_034520 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.179e-48
Identity = 123/200 (61.50%), Postives = 138/200 (69.00%), Query Frame = 3
Query:   12 HYNFVSDGSPRGMFGGPPQHPGTFHRVWNPSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSN-----SSGIKRAKVSEASSK----QSLAEYLAASFNKAVEGTE 584
            +Y+  SDGSP GMFG P  HPGT  R WNPSN S Y   P PGFSPAD     YG  RPQ FG  P+     G S   S GRGRG GY GS   G+GRS GRG GFHGHSSASN+M+GPE ++DESML+DPWQHLKP+ WRR+EAGMDSL  P +SN     S   K+ KVSEAS+K     SLAEYLAASFNKAVE T+
Sbjct:  170 YYSSASDGSPGGMFGTPLMHPGTTPRFWNPSNASRYSNSPTPGFSPAD---IPYGRGRPQQFGNYPLPSPGHGGSLGLSSGRGRGRGYGGSITHGIGRSGGRGLGFHGHSSASNRMMGPESFYDESMLEDPWQHLKPVLWRRREAGMDSLSNPDSSNSWFPKSISAKKVKVSEASNKFNSQLSLAEYLAASFNKAVEDTK 366          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: E0CRX4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0001g07660 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.575e-14
Identity = 81/193 (41.97%), Postives = 105/193 (54.40%), Query Frame = 3
Query:   63 PQHPGTFHRVWN----------PSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNSS---------GIKRAKVSEA----SSKQSLAEYLAASFNKAV 572
            P H GT   VWN          PSN+   G  P+PGF P    SF  G  R   F  +P      G S S + GRGR   +  S  PG GR  GRG GFH H SA ++   PE ++++SM++DPW+ LKP+ W R++A    LG  G ++ S          +K+ +VSEA    SS+QSLAEYLAASFN+AV
Sbjct:  157 PAHQGT-PGVWNGSNGMPRYGVPSNSPRGGNFPSPGFRPVGSPSFRSGRGRGHWFNNSPSPVSGRGGSSSPNSGRGRSGWFGNSMSPGSGRGRGRGLGFHAHVSAQDR---PELFYNKSMVEDPWKFLKPVIWSREKA----LGKMGNASDSPKSWLPKSINMKKTRVSEATNESSSQQSLAEYLAASFNEAV 341          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: M5XUP9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa016470mg PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.175e-12
Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  342 SASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTS-----NSSGIKRAKVSEASSKQ----SLAEYLAASFNKAVEGT 581
            S   K LGPE Y+++SM++DPW+ LKP+ W+  +  M    +PG+S     NSS  K A +SE S+K     SLAEYLAASFN AV+ T
Sbjct:  307 STMEKQLGPERYYNDSMVEDPWKFLKPVIWKGVDTPMKRFYSPGSSKPPIENSSSTKDAIISEGSNKSTSQPSLAEYLAASFNDAVKDT 395          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: W9SMI8_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_000896 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.902e-12
Identity = 39/82 (47.56%), Postives = 57/82 (69.51%), Query Frame = 3
Query:  351 NKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSN-----SSGIKRAKVSEASSKQ----SLAEYLAASFNKA 569
            ++ LGPE ++DESM++D W+ L+P+ WR  +A + SL  P +S      S G K+AKVS+++SK     SLAEYLAASF++A
Sbjct:  258 DRQLGPERFYDESMIEDAWKFLEPVVWREVDASLSSLSTPDSSKSWITRSLGAKKAKVSDSTSKSGSQPSLAEYLAASFDEA 339          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: B9RJY3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1039650 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.443e-12
Identity = 63/157 (40.13%), Postives = 82/157 (52.23%), Query Frame = 3
Query:  132 NPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSNS---SGIKRAK------VSEASSKQSLAEYLAASFNKAVE 575
            NPGF PA   SFNYG  RP   G +P            S   GRG G    S  G        +GFH    A  +  GPE ++++SM++DPW+ L+P+ W+        LG PG+SNS     I R K       + ++SKQSLAEYLAASFN+AV+
Sbjct:  261 NPGFQPAGSPSFNYGQGRPPWSGNSP---SPRSVHGGSSTYSGRGQGQWHGSSRGQISGQSGRRGFHSRGPAPGEAFGPESFYEKSMVEDPWKQLEPVVWKM-------LGVPGSSNSWLPKSISRKKPRPSESSNNSNSKQSLAEYLAASFNEAVK 407          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: A0A067H0Z1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g022755mg PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.440e-11
Identity = 91/214 (42.52%), Postives = 116/214 (54.21%), Query Frame = 3
Query:    3 ATEHYNFVSDG--SPRGM---FGGPPQHPGTFHRVWN----------PSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSN-----SSGIKRAKVSEA----SSKQSLAEYLAASFNKAV 572
             T HY+    G  SPRGM   F G   H GT    WN          PS  S  G++ +P F P    +F YG  RPQ  GR+P      G SP  S GRGRG  Y  S  PGLG S GRG+G H     ++   GPEC++D+SM +DPWQ L+P+ W+ +     +  +PG+SN     S  +K+ +VSEA    SS+ SLAEYLAASFN+A 
Sbjct:   81 TTSHYSPTIYGQRSPRGMASPFTG--IHQGT-PESWNGSGGTARYNSPSTASGGGQIFSPSFGPVRSPTFGYGQGRPQWQGRSPSPGSGRGGSPGPSSGRGRGRWYGSSVSPGLGCSGGRGRGLHSRGFGADGKQGPECFYDKSMDEDPWQELEPLAWKSR-----NFKSPGSSNSWFPKSISMKKPRVSEASRQSSSQPSLAEYLAASFNEAT 286          
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Match: V4SH86_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10001506mg PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.535e-11
Identity = 91/214 (42.52%), Postives = 116/214 (54.21%), Query Frame = 3
Query:    3 ATEHYNFVSDG--SPRGM---FGGPPQHPGTFHRVWN----------PSNTSSYGKLPNPGFSPADGRSFNYGAARPQMFGRNPILDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHGHSSASNKMLGPECYFDESMLKDPWQHLKPIPWRRQEAGMDSLGAPGTSN-----SSGIKRAKVSEA----SSKQSLAEYLAASFNKAV 572
             T HY+    G  SPRGM   F G   H GT    WN          PS  S  G++ +P F P    +F YG  RPQ  GR+P      G SP  S GRGRG  Y  S  PGLG S GRG+G H     ++   GPEC++D+SM +DPWQ L+P+ W+ +     +  +PG+SN     S  +K+ +VSEA    SS+ SLAEYLAASFN+A 
Sbjct:  168 TTIHYSPTIYGQRSPRGMASPFTG--IHQGT-PESWNGSGGTARYNSPSTASGGGQIFSPSFGPVRSPTFGYGQGRPQWQGRSPSPGSGRGGSPGPSSGRGRGRWYGSSVSPGLGCSGGRGRGLHSRGFGADGKQGPECFYDKSMDEDPWQELEPLAWKSR-----NFKSPGSSNSWFPKSISMKKPRVSEASRQSSSQPSLAEYLAASFNEAT 373          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 20
Match NameE-valueIdentityDescription
A0A0B0MYW9_GOSAR1.346e-103100.00Epidermal growth factor receptor OS=Gossypium arbo... [more]
A0A0D2QT54_GOSRA1.553e-9995.88Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FFF7_THECC7.259e-4961.50Hydroxyproline-rich glycoprotein family protein, p... [more]
A0A061FEH0_THECC1.179e-4861.50Hydroxyproline-rich glycoprotein family protein, p... [more]
E0CRX4_VITVI7.575e-1441.97Putative uncharacterized protein OS=Vitis vinifera... [more]
M5XUP9_PRUPE2.175e-1248.31Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
W9SMI8_9ROSA2.902e-1247.56Uncharacterized protein OS=Morus notabilis GN=L484... [more]
B9RJY3_RICCO3.443e-1240.13Putative uncharacterized protein OS=Ricinus commun... [more]
A0A067H0Z1_CITSI1.440e-1142.52Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4SH86_9ROSI4.535e-1142.52Uncharacterized protein OS=Citrus clementina GN=CI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0016633 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028265M-phase-specific PLK1-interacting protein-likePFAMPF15502MPLKIPcoord: 91..126
e-value: 1.7E-7
score: 31.2
NoneNo IPR availablePANTHERPTHR36054:SF1HYDROXYPROLINE-RICH GLYCOPROTEIN FAMILY PROTEINcoord: 41..179
NoneNo IPR availablePANTHERPTHR36054FAMILY NOT NAMEDcoord: 41..179

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0016633 ID=g.arboreum_cottongen_reftransV1_0016633|Name=g.arboreum_cottongen_reftransV1_0016633|organism=Gossypium arboreum|type=contig|length=930bp
AGGCCACTGAACATTATAACTTTGTTTCTGATGGAAGTCCAAGAGGAATG
TTTGGTGGTCCTCCCCAGCATCCTGGAACTTTTCATAGGGTCTGGAATCC
CTCTAATACATCAAGCTATGGTAAATTACCTAACCCCGGCTTTTCTCCAG
CAGATGGTCGTAGTTTCAATTATGGAGCAGCCAGGCCACAAATGTTTGGT
AGAAATCCAATCCTTGATCAAAGACCTGGAAGTAGTCCTAGTTTCAGTCC
AGGAAGAGGCAGGGGTCCTGGATACCGAGGGAGCAGTGGTCCTGGTTTAG
GAAGGAGTGCTGGACGAGGGCAAGGCTTTCATGGTCATAGCTCAGCATCA
AACAAGATGTTAGGGCCAGAGTGTTACTTTGATGAATCCATGTTGAAAGA
TCCTTGGCAGCATTTAAAACCTATTCCATGGAGAAGACAAGAAGCTGGAA
TGGATAGTTTGGGTGCACCAGGCACTTCGAACTCCAGTGGCATAAAAAGG
GCAAAAGTTTCAGAGGCTTCTTCTAAACAAAGTCTTGCTGAATACCTTGC
TGCTTCATTCAACAAAGCTGTTGAAGGCACAGAATGAAGGTTGCTCAAAT
CTGAAATGAATGGCAATGTAGAAGAGATCTGTTATGACCATTTAGGTGAT
ATTTGGATTCCATTATTGAGGCTTGAAGATGGGGTGGCTGAAGGCATGAA
TGTGGATATACATATTTTTCGGATAACAATATTGGGGTAGACATTCTGAG
ATGGTTATCGCCCATTCTCATTAATCTCACCAGTCCTATCTCGGGATTCA
AATTCTAAATTCTAAAATTTGATAACAATATTTTTCTATGTTCAGGACTG
GTGGGATATTTTCTCATAGTATTCTTGTCAGAAAATATTATCATGTGAAT
TATCTTAATAATAACAACACAGTTTCCGCA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR028265TTDN1/SICKLE