g.arboreum_cottongen_reftransV1_0018556, g.arboreum_cottongen_reftransV1_0018556 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0018556
Unique Nameg.arboreum_cottongen_reftransV1_0018556
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1594
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr6chromosomeg.arboreum_cottongen_reftransV1_0018556:1..1564 .
Chr6:32237047..32239472 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A0D2R616_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G008400 PE=4 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 300/317 (94.64%), Postives = 306/317 (96.53%), Query Frame = -2
Query:  640 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTGDLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1590
            S  +E HS ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFS+SSLHNRRPIEGFTGCPSVNELVS VGIED+GEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLPKNRNA+CGQHKEEVLHQLRELAKSEP LSFDNT DLQTGTVHTSCTNDTAPI FPAYESSALRFFGDNVEMTD+VFVPFSELRGH EECAVVPDKHLGSSRTIPVSDSLGNQQHQID GTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESR RIKGRFAK+EH
Sbjct:   37 SCDREVHS-ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSTSSLHNRRPIEGFTGCPSVNELVSFVGIEDVGEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLPKNRNANCGQHKEEVLHQLRELAKSEPTLSFDNTDDLQTGTVHTSCTNDTAPISFPAYESSALRFFGDNVEMTDKVFVPFSELRGHTEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDAGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRARIKGRFAKLEH 352          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A061DQF5_THECC (B-box type zinc finger protein with CCT domain, putative OS=Theobroma cacao GN=TCM_004548 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 9.025e-141
Identity = 245/338 (72.49%), Postives = 268/338 (79.29%), Query Frame = -2
Query:  640 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLG--------EKKXXXXXXXXXXXXXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFD------------NTGDLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQ-QHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1590
            S  +E HS ANQLF++H RSQLCDACD SPASIFCETEQSVFCSNCDWESHK SSSSLHNRRPIEGF+GCPSV+ELV+  GIEDLG        EK G  D G DDG LDLLSWE P  SS DDL+VSSD  HGFKPTDV PL KNRNA CG+HKEE+L QLRELAKSEP LS D            NT + Q G+VHTSC  D  PIPFPAYE SA + F DNVEM +QVF+PFS+LRG+ EE AVVP++HL +SRT  V+DSL +Q QHQI  GT SALPK+ VHELNSQERDSAISRYKEKRKTRR+DKHIRYESRKVRAESRTRIKGRFAKVEH
Sbjct:   37 SCDREVHS-ANQLFTRHPRSQLCDACDKSPASIFCETEQSVFCSNCDWESHKCSSSSLHNRRPIEGFSGCPSVSELVNSFGIEDLGSKTLFLSEEKVGCGDGGEDDGLLDLLSWETPEFSSLDDLIVSSDFGHGFKPTDVPPLRKNRNASCGRHKEEMLLQLRELAKSEPNLSTDFENVTGFLPLLPNTYNSQPGSVHTSCKIDKDPIPFPAYELSAPQCFSDNVEMANQVFLPFSQLRGYTEESAVVPNEHLDTSRTAHVNDSLEDQLQHQIAAGTTSALPKIVVHELNSQERDSAISRYKEKRKTRRYDKHIRYESRKVRAESRTRIKGRFAKVEH 373          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A0D2TTQ8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G008400 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 6.634e-123
Identity = 232/317 (73.19%), Postives = 241/317 (76.03%), Query Frame = -2
Query:  640 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTGDLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1590
            S  +E HS ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFS+SSLHNRRPIEGFTGCPSVNELVS VGIED+GEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLP                      KS  +  F +  ++           D   +PF                         SELRGH EECAVVPDKHLGSSRTIPVSDSLGNQQHQID GTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESR RIKGRFAK+EH
Sbjct:   37 SCDREVHS-ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSTSSLHNRRPIEGFTGCPSVNELVSFVGIEDVGEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLP----------------------KSSALRFFGDNVEM----------TDKVFVPF-------------------------SELRGHTEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDAGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRARIKGRFAKLEH 295          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A0D2R4H8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G140600 PE=4 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 5.982e-111
Identity = 196/329 (59.57%), Postives = 234/329 (71.12%), Query Frame = -2
Query:  643 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDN---------TGDLQTGTVHTSCTNDTAPIPFPAYESSALRF--FGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQQH--QIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVE 1590
            S  +E HS ANQLF+KHSRSQLCDACD SPAS+FCETEQSVFCSNCDWE H+    SLHNRRP+E FTGCPSV+EL+S +GIEDLG  K       D     L +WE P+IS FD ++V +D DHGFK TDV PLPKNRN+ CGQHKEE+ HQL ELAKS+P L+F           T   Q  ++  SC ND  P+  PA E+S L+   F DNVE+T+Q  +       + EE A V + H+  SR I V+D   +QQ   Q   GT+SALPKV+VHELNSQER++AISRYKEK+KTRR+DKH+RYESRK RAESRTRIKGRFAKV+
Sbjct:   36 SCDREVHS-ANQLFTKHSRSQLCDACDESPASLFCETEQSVFCSNCDWERHR---CSLHNRRPVEVFTGCPSVSELLSFLGIEDLGNDKASCWSEDDGFLDFL-TWECPLISGFDGVIVPNDMDHGFKATDVPPLPKNRNSSCGQHKEEIFHQLHELAKSDPTLTFQKIDLQSLIPETDHFQPASMQPSCNNDADPVSCPALETSPLQCLKFNDNVEITNQALL-------YTEENARVANTHVDCSRNIDVNDGPEDQQMKPQTGVGTISALPKVSVHELNSQERETAISRYKEKKKTRRYDKHVRYESRKARAESRTRIKGRFAKVK 352          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A0D2PL15_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G008400 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.171e-98
Identity = 182/194 (93.81%), Postives = 186/194 (95.88%), Query Frame = -2
Query: 1009 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTGDLQTGTVHTSCTNDTAPIPFPAYE 1590
            S  +E HS ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFS+SSLHNRRPIEGFTGCPSVNELVS VGIED+GEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLPKNRNA+CGQHKEEVLHQLRELAKSEP LSFDNT DLQTGTVHTSCTNDTAPI FPAYE
Sbjct:   37 SCDREVHS-ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSTSSLHNRRPIEGFTGCPSVNELVSFVGIEDVGEKKGGDDCGYDDGWLDLLSWENPVISSFDDLLVSSDSDHGFKPTDVLPLPKNRNANCGQHKEEVLHQLRELAKSEPTLSFDNTDDLQTGTVHTSCTNDTAPISFPAYE 229          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: V4TAX4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10020545mg PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.259e-94
Identity = 177/344 (51.45%), Postives = 223/344 (64.83%), Query Frame = -2
Query:  640 QEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSS---SSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXX----------XXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTGD---------------LQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSD--SLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1581
            +E HS  NQLFSKHSRSQLCD CD SPASIFCETE SV C+NCDWESH  S+   SS+HNRRPIE F+GCPSVNE+ +I+G +DL  K    +    +             DL +WE P   S DDL+VSS++ H F+   V PLPKNRNA  GQHKEE+LHQLR+LAK +P   ++N                   Q G ++T    D  P  FPAYE+S L++FGD+ +  +Q+  P +  +   EE  +VP+KH  +   +   +    G  QH  +T   S   +V+VHELNSQERDSA+SRYKEK+KTRR+DKH+RYESRKVRAESRTRIKGRFAK++H
Sbjct:   47 KEVHS-TNQLFSKHSRSQLCDVCDASPASIFCETEHSVLCTNCDWESHSQSNLRVSSVHNRRPIESFSGCPSVNEMFAIIGFDDLDSKALFLNDETRNYSHFDGVDSDGFSDLFAWETPDFVSLDDLIVSSNAGHNFQAIGVPPLPKNRNAAGGQHKEEMLHQLRQLAKLDPNFKYENANIDEPIVGFHSLVPEPISQPGNMNTGSELDAEPNRFPAYEASTLQWFGDSFDHANQL--PSTLFKSCKEESFIVPEKHFDTDGFVKNINEGGEGQSQHPTNTEKSSVFHRVSVHELNSQERDSALSRYKEKKKTRRYDKHVRYESRKVRAESRTRIKGRFAKIDH 387          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A067H8R2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g016553mg PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.259e-94
Identity = 177/344 (51.45%), Postives = 223/344 (64.83%), Query Frame = -2
Query:  640 QEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSS---SSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXX----------XXXLSWENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTGD---------------LQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSD--SLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1581
            +E HS  NQLFSKHSRSQLCD CD SPASIFCETE SV C+NCDWESH  S+   SS+HNRRPIE F+GCPSVNE+ +I+G +DL  K    +    +             DL +WE P   S DDL+VSS++ H F+   V PLPKNRNA  GQHKEE+LHQLR+LAK +P   ++N                   Q G ++T    D  P  FPAYE+S L++FGD+ +  +Q+  P +  +   EE  +VP+KH  +   +   +    G  QH  +T   S   +V+VHELNSQERDSA+SRYKEK+KTRR+DKH+RYESRKVRAESRTRIKGRFAK++H
Sbjct:   47 KEVHS-TNQLFSKHSRSQLCDVCDASPASIFCETEHSVLCTNCDWESHSQSNLRVSSVHNRRPIESFSGCPSVNEMFAIIGFDDLDSKALFLNDETRNYSHFDGVDSDGFSDLFAWETPDFVSLDDLIVSSNAGHNFQAIGVPPLPKNRNAAGGQHKEEMLHQLRQLAKLDPNFKYENANIDEPIVGFHSLVPEPISQPGNMNTGSELDAEPNRFPAYEASTLQWFGDSFDHANQL--PSTLFKSCKEESFIVPEKHFDTDGFVKNINEGGEGQSQHPTNTEKSSVFHRVSVHELNSQERDSALSRYKEKKKTRRYDKHVRYESRKVRAESRTRIKGRFAKIDH 387          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: B9S3V9_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0555710 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.976e-93
Identity = 186/364 (51.10%), Postives = 221/364 (60.71%), Query Frame = -2
Query:  643 SLSQEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLS-----------------WENPVIXXXXXXXXXXXXDHGFKPTDVLPLPK----------------NRNAHCGQHKEEVLHQLRELA-----------KSEPILSFDNTG--DLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDK--HLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVE 1590
            S  +E HS  NQLFSKH+RS LCD+CD SPASIFCETE SVFC NCDWE H  S SS+HNRRPIEGF+G PSV+ELVSI+G EDLG+KK      +++G   L S                 WE P + S DDL+VSSDS   F    V PLPK                NRNA CGQHKEE+L QLRELA           ++EP   F +    ++QT   H  C     PI  P+YE +   +  DN E  +QV VP +  R H EE  VVPDK  ++  S +       G  Q+   TG +S  PKV  H++NSQERDSAISRYKEKRKTRR+DKHIRYESRK RAESRTRI+GRFAK++
Sbjct:   48 SCDREVHS-TNQLFSKHTRSLLCDSCDASPASIFCETEHSVFCQNCDWEKHNLSLSSVHNRRPIEGFSGFPSVSELVSILGFEDLGDKKDKKALLFNEGDNGLASSGPDGSGFEDGYSDLLIWETPAVVSIDDLIVSSDSGPNFPALGVPPLPKAIVFRFSLFYFSCKSQNRNAVCGQHKEEILRQLRELAGLEPDPNCHNPETEPTYVFQSAAGENMQTRMTHKCCEPVARPISSPSYEENIFNWLSDNGEAGNQVSVPCTLPRSHLEESPVVPDKQSNIDGSASYANGSHEGEPQYPASTGLISVFPKVVSHDINSQERDSAISRYKEKRKTRRYDKHIRYESRKARAESRTRIRGRFAKMD 410          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: M5VM63_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa006893mg PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 3.659e-88
Identity = 165/346 (47.69%), Postives = 217/346 (62.72%), Query Frame = -2
Query:  640 QEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLS---------------------WENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDNTG-----------DLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH 1581
            +E HS ANQLFSKH+RS LCDACDGSPASIFC TE SV C NCDWESH  SSSS+H+RRP+EGF+GCP +NEL+++VG E++ +K          G                           W+ P + S DDL+VS+ + + F+   V PLPKNRNA CG+HKEE+  QLR L KSEP L  +N             ++Q G++ T   +D  P  FPAYE+   ++  D      +   P + +R + +EC VVPDKH  +  +   ++       Q+++   SA PKVA HEL+SQ R++A+SRYKEK+KTRR++KHIRYESRKVRAESRTRIKGRFAK++H
Sbjct:   49 REVHS-ANQLFSKHTRSLLCDACDGSPASIFCTTESSVLCQNCDWESHNLSSSSVHDRRPLEGFSGCPCLNELLTVVGFENMDKKALLLSDESGGGGGGGDGFLGCGVDGSFDLDDGFSDFLVWDTPSVVSLDDLIVSNPA-YKFQAMGVPPLPKNRNAACGRHKEEIFRQLRVLVKSEPNLFSENVDVKPLKSLASEQNMQRGSLFTGFEHDAEPTVFPAYEAHDFQY-NDCGAAEKRESSPKTFIRSYLQECCVVPDKHSYNDGSASHANDGHGHGGQMNSEASSAFPKVAAHELSSQNRETALSRYKEKKKTRRYEKHIRYESRKVRAESRTRIKGRFAKMDH 391          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Match: A0A067K755_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13861 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 9.889e-83
Identity = 164/333 (49.25%), Postives = 196/333 (58.86%), Query Frame = -2
Query:  643 NQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLS-------------WENPVIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEPILSFDN--------------TGDLQTGTVHTSCTNDTAPIPFPAYESSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDKHLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVE 1560
            N+LFSKH+RS LCDACD SPASIFCETE SV C NCDWE H  S SS+HNRRPIEGF+GC SV+ELVSI G ED+G+KK              L              WE+P +S  D + +S    + F+  +V PLPKNRNA CG+HKEE+L QLRELA+SEP  ++ N                + Q   +HT C            E +  ++  D  E   QV VP +  R   EE  +V DK             L N  H       + +PK+  HELNSQERDSAISRYKEKRKTRR+DKHIRYESRKVRAESRTRIKGRFAK++
Sbjct:   38 NKLFSKHTRSLLCDACDASPASIFCETEHSVLCQNCDWERHSLSVSSVHNRRPIEGFSGCRSVSELVSIWGFEDIGDKKALFLNEDSGLVGSGLDGSGFGDGYSDLLVWESPAVSIDDLIGLSGSGQN-FQALEVPPLPKNRNAVCGRHKEEILGQLRELARSEPDSNWKNPHTEPINVFQSSAEGQNRQLQNMHTGC------------EENVFQWISDPGEAGVQVSVPCTAARSDLEENFIVLDK-------------LVNGSH-----GATRVPKIGSHELNSQERDSAISRYKEKRKTRRYDKHIRYESRKVRAESRTRIKGRFAKID 339          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL13_ARATH (Zinc finger protein CONSTANS-LIKE 13 OS=Arabidopsis thaliana GN=COL13 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.091e-71
Identity = 144/312 (46.15%), Postives = 193/312 (61.86%), Query Frame = -2
Query:  646 LANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESHKFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKKXXXXXXXXXXXXXXLSWENP-VIXXXXXXXXXXXXDHGFKPTDVLPLPKNRNAHCGQHKEEVLHQLRELAKSEP-ILSFDN-TGDLQTGTVHTSCTNDTAPIPFPAYE-SSALRFFGDNVEMTDQVFVPFSELRGHPEECAVVPDK-HLGSSRTIPVSDSLGNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKV 1566
            +ANQLF+KH RS LCD+C+ SP+S+FCETE+SV C NCDW+ H  +SSSLH+RRP EGFTGCPSV EL++IVG++DL                  L WE+P ++S  D ++      H F+ TDV PLPKNR+A CG++K+E++ QLR L++SEP  L F+    ++  G          AP  F   E  S L++F    +  D    P+  L  +  E    P+     SS  +PVS  L   + +     V    +   HE+NS ER+SA+SRYKEK+K+RR++KHIRYESRKVRAESRTRI+GRFAK 
Sbjct:   42 VANQLFAKHFRSLLCDSCNESPSSLFCETERSVLCQNCDWQHHT-ASSSLHSRRPFEGFTGCPSVPELLAIVGLDDL-------------TLDSGLLWESPEIVSLNDLIVSGGSGTHNFRATDVPPLPKNRHATCGKYKDEMIRQLRGLSRSEPGCLKFETPDAEIDAGFQFL------APDLFSTCELESGLKWF----DQQDHEDFPYCSLLKNLSESDEKPENVDRESSVMVPVSGCLNRCEEETVMVPVITSTRSMTHEINSLERNSALSRYKEKKKSRRYEKHIRYESRKVRAESRTRIRGRFAKA 329          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL14_ARATH (Zinc finger protein CONSTANS-LIKE 14 OS=Arabidopsis thaliana GN=COL14 PE=2 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.458e-16
Identity = 44/87 (50.57%), Postives = 55/87 (63.22%), Query Frame = -2
Query: 1324 QEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESH-KFSSSSLHNRRPIEGFTGCPSVNELVSIVGIEDLGEKK 1581
            Q  HS AN L  KH RSQ+CD C   P S+ C T+  V C  CDW+ H   SSS+ H R  +EGF+GCPSV EL ++ GI+  G+KK
Sbjct:   37 QHVHS-ANLLSRKHVRSQICDNCSKEPVSVRCFTDNLVLCQECDWDVHGSCSSSATHERSAVEGFSGCPSVLELAAVWGIDLKGKKK 122          

HSP 2 Score: 73.9442 bits (180), Expect = 8.119e-13
Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = -2
Query:  646 ELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKV 792
            E  +Q RD+A+ RYKEK+KTRR+DK IRYE+RK RAE+R R+KGRF K 
Sbjct:  351 EQMAQNRDNAMQRYKEKKKTRRYDKTIRYETRKARAETRLRVKGRFVKA 399          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL15_ARATH (Zinc finger protein CONSTANS-LIKE 15 OS=Arabidopsis thaliana GN=COL15 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.085e-13
Identity = 36/81 (44.44%), Postives = 49/81 (60.49%), Query Frame = -2
Query: 1342 QEKHSLANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESH-KFSSSSLHNRRPIEGFTGCPSVNELVSIVGIE 1581
            Q+ H+ AN L  KH RSQ+CD C   P S+ C T+  + C  CDW+ H   S S  H R  +EGF+GCPS  EL ++ G++
Sbjct:   34 QQVHT-ANLLSRKHVRSQICDNCGNEPVSVRCFTDNLILCQECDWDVHGSCSVSDAHVRSAVEGFSGCPSALELAALWGLD 113          

HSP 2 Score: 70.0922 bits (170), Expect = 1.597e-11
Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = -2
Query:  631 SQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVEH*DY 783
            +Q R  A+ RYKEKRKTRR+DK IRYESRK RA++R R++GRF K     Y
Sbjct:  382 AQNRGDAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVRGRFVKASEAPY 432          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL5_ARATH (Zinc finger protein CONSTANS-LIKE 5 OS=Arabidopsis thaliana GN=COL5 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.464e-12
Identity = 33/69 (47.83%), Postives = 48/69 (69.57%), Query Frame = -2
Query:  649 GNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAK 855
            GN  + ++  T+++      H+ +S +R++ + RY+EKRK R+F+K IRY SRK  AESR RIKGRFAK
Sbjct:  258 GNTNNSVNRSTITSSTTGGDHQASSMDREARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAK 326          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL2_ARATH (Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis thaliana GN=COL2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.530e-11
Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = -2
Query:  649 VSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAK 822
            +S  P   V +L   ER++ + RY+EK+KTR+FDK IRY SRK  AE R RIKGRFAK
Sbjct:  262 LSGPPTQVVQQLTPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAK 319          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL4_ARATH (Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis thaliana GN=COL4 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 1.070e-10
Identity = 36/69 (52.17%), Postives = 43/69 (62.32%), Query Frame = -2
Query:  649 GNQQHQIDTGTVSALPKVAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAK 855
            G      D GT  A+P      L S ER++ + RY+EKRK R+F+K IRY SRK  AE R RIKGRFAK
Sbjct:  274 GPATSGADPGTQRAVP------LTSAEREARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAK 336          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL10_ARATH (Zinc finger protein CONSTANS-LIKE 10 OS=Arabidopsis thaliana GN=COL10 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.020e-10
Identity = 31/73 (42.47%), Postives = 44/73 (60.27%), Query Frame = -2
Query: 1354 ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESH---KFSSSSLHNRRPIEGFTGCPSVNELVSI 1563
            AN L  +HSR+ +C+ C+  PAS+ C  E+   C NCDW  H     +++S H R+ I  ++GCPS  EL SI
Sbjct:   35 ANALSKRHSRTLVCERCNAQPASVRCSDERVSLCQNCDWSGHDGKNSTTTSHHKRQTINCYSGCPSSAELSSI 107          

HSP 2 Score: 62.003 bits (149), Expect = 5.478e-9
Identity = 26/42 (61.90%), Postives = 34/42 (80.95%), Query Frame = -2
Query:  649 RDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAK 774
            R++A+ RYKEK+K R+FDK +RY SRK RA+ R R+KGRF K
Sbjct:  316 RNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVK 357          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL9_ARATH (Zinc finger protein CONSTANS-LIKE 9 OS=Arabidopsis thaliana GN=COL9 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.108e-9
Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = -2
Query:  631 RDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKV-EH*DY 774
            R++A+ RYKEK+K R+FDK +RY SRK RA+ R R+KGRF K  E  DY
Sbjct:  315 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAGEAYDY 363          

HSP 2 Score: 62.003 bits (149), Expect = 5.131e-9
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = -2
Query: 1354 ANQLFSKHSRSQLCDACDGSPASIFCETEQSVFCSNCDWESH----------KFSSSSLHNRRPIEGFTGCPSVNELVSI 1563
            AN L  +HSR+ +C+ C+  PA++ C  E+   C NCDW  H            +S   H R+ I  ++GCPS +EL SI
Sbjct:   35 ANALSKRHSRTLVCERCNAQPATVRCVEERVSLCQNCDWSGHNNSNNNNSSSSSTSPQQHKRQTISCYSGCPSSSELASI 114          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: CONS_ARATH (Zinc finger protein CONSTANS OS=Arabidopsis thaliana GN=CO PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.143e-9
Identity = 33/67 (49.25%), Postives = 44/67 (65.67%), Query Frame = -2
Query:  643 GTVSALPK-----VAVHELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAKVE 828
            GTV   P      + V +L+  +R++ + RY+EKRKTR+F+K IRY SRK  AE R R+ GRFAK E
Sbjct:  283 GTVEQQPDPASQMITVTQLSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKRE 349          
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Match: COL3_ARATH (Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis thaliana GN=COL3 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.767e-9
Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = -2
Query:  649 ELNSQERDSAISRYKEKRKTRRFDKHIRYESRKVRAESRTRIKGRFAK 792
            +L+  ER++ + RY+EKRK R+F+K IRY SRK  AE R RIKGRFAK
Sbjct:  223 QLSPAEREARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAK 270          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2R616_GOSRA0.000e+094.64Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DQF5_THECC9.025e-14172.49B-box type zinc finger protein with CCT domain, pu... [more]
A0A0D2TTQ8_GOSRA6.634e-12373.19Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2R4H8_GOSRA5.982e-11159.57Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PL15_GOSRA2.171e-9893.81Uncharacterized protein OS=Gossypium raimondii GN=... [more]
V4TAX4_9ROSI1.259e-9451.45Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A067H8R2_CITSI1.259e-9451.45Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
B9S3V9_RICCO1.976e-9351.10Putative uncharacterized protein OS=Ricinus commun... [more]
M5VM63_PRUPE3.659e-8847.69Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A0A067K755_JATCU9.889e-8349.25Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0018556 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
COL13_ARATH2.091e-7146.15Zinc finger protein CONSTANS-LIKE 13 OS=Arabidopsi... [more]
COL14_ARATH1.458e-1650.57Zinc finger protein CONSTANS-LIKE 14 OS=Arabidopsi... [more]
COL15_ARATH4.085e-1344.44Zinc finger protein CONSTANS-LIKE 15 OS=Arabidopsi... [more]
COL5_ARATH4.464e-1247.83Zinc finger protein CONSTANS-LIKE 5 OS=Arabidopsis... [more]
COL2_ARATH5.530e-1156.90Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis... [more]
COL4_ARATH1.070e-1052.17Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis... [more]
COL10_ARATH2.020e-1042.47Zinc finger protein CONSTANS-LIKE 10 OS=Arabidopsi... [more]
COL9_ARATH1.108e-959.18Zinc finger protein CONSTANS-LIKE 9 OS=Arabidopsis... [more]
CONS_ARATH2.143e-949.25Zinc finger protein CONSTANS OS=Arabidopsis thalia... [more]
COL3_ARATH3.767e-960.42Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000315B-box-type zinc fingerSMARTSM00336bboxneu5coord: 17..63
e-value: 6.6E-4
score: 29.0
IPR000315B-box-type zinc fingerPFAMPF00643zf-B_boxcoord: 19..63
e-value: 1.5E-7
score: 31.3
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 17..63
score: 10.509
IPR010402CCT domainPFAMPF06203CCTcoord: 272..314
e-value: 4.5E-17
score: 61.7
IPR010402CCT domainPROSITEPS51017CCTcoord: 272..314
score: 15.12
NoneNo IPR availablePANTHERPTHR31717:SF16ZINC FINGER PROTEIN CONSTANS-LIKE 13coord: 9..315
NoneNo IPR availablePANTHERPTHR31717FAMILY NOT NAMEDcoord: 9..315

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0018556 ID=g.arboreum_cottongen_reftransV1_0018556|Name=g.arboreum_cottongen_reftransV1_0018556|organism=Gossypium arboreum|type=contig|length=1594bp
ACTGACAGCAGCATTACTAGTAGTACCACTGTGGGTCAAAACTTCCAGAA
ACAAGACCGCAATATTTCTCGTCATCCTAGACGTCACCACAGGGCAGCAA
TGGCTGTCAGTATCTTAGGCCAAGAAGGTAACTCGCATGTCCAATCGAAG
AAAGACCGGATTTTGTTTTATATGGTTGTTGGCGTCTTTGGTTTTGCATT
TGGCTCATAGCACACGCCATATTCAACATGAGTATTTAATGAACTTCCCA
ATGGTGTTAAATTTGTAGCCAAGCTGGTTGTGGAATCTCATTACAGTAAA
AAATGGAATATTCTCAACATAGAACTCAAATTTCACTAACCATCGTTTTA
TTTTGCATGACATGATTGCAAAAAGTCCAAGATTCCAAATAAGGGCTTTC
ACTGCTGTAGCCAATAATCAGCATTTCAATGCACAAACCATCAGCTTAAA
GGTTAAAAAATAGCCTACATGATGTAATTATAGGTATTACAATTCAATAT
TTTACAAGAAACCTTGCATCTTACTAAGATTTTAGCTTCAAAGGAACAAA
GAATGAACAAAGGAAAACATTATCTAGTTACAAAAATGATCCATGTTCAT
AGCAATTCCAGTCTCAAAAGTAGTTTACCAGTAATCTCAATGCTCCACCT
TCGCAAAACGTCCTTTAATTCTCGTCCTGCTTTCGGCTCTAACCTTTCTT
GATTCGTACCTGATGTGCTTATCGAATCTCCTTGTTTTCCTTTTCTCCTT
GTAGCGCGAGATCGCAGAGTCTCTCTCCTGGCTATTTAACTCGTGGACAG
CGACCTTTGGAAGTGCTGACACGGTTCCAGTATCAATTTGATGTTGTTGG
TTCCCAAGACTATCACTCACAGGTATAGTCCTACTTGAACCTAGATGTTT
ATCAGGAACCACAGCACATTCCTCAGGATGACCTCTTAATTCCGAGAAAG
GCACAAAAACTTGGTCGGTCATCTCAACGTTGTCGCCGAAGAACCGTAGT
GCGCTTGACTCATAAGCAGGAAATGGAATTGGAGCTGTATCATTTGTGCA
ACTTGTATGCACAGTTCCTGTCTGCAAATCACCAGTATTATCAAAGCTGA
GGATAGGTTCAGATTTTGCTAGTTCACGTAGTTGATGAAGTACTTCCTCT
TTATGTTGTCCACAATGAGCATTACGATTCTTGGGCAAAGGAAGAACATC
AGTTGGCTTAAACCCATGATCAGAATCACTCGAAACAAGCAAATCATCAA
AGCTAGAAATCACCGGATTTTCCCAGCTCAACAAATCCAACCACCCATCA
TCATATCCACAATCATCACCACCTTTCTTTTCACCCAAATCCTCAATCCC
AACAATACTCACCAACTCATTCACCGAAGGACACCCAGTAAACCCTTCTA
TTGGCCTCCTATTATGCAACGAAGACGACGAAAACTTGTGGCTTTCCCAA
TCACAGTTGGAGCAAAACACCGATTGCTCTGTTTCGCAAAAGATGGAAGC
AGGGGAACCATCACAAGCGTCACAGAGCTGTGACCGAGAGTGCTTAGAGA
ATAGTTGGTTAGCCAAGCTATGTTTTTCTTGTGACAGGGAAGTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR000315Znf_B-box
IPR010402CCT_domain
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular