g.arboreum_cottongen_reftransV1_0021779, g.arboreum_cottongen_reftransV1_0021779 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0021779
Unique Nameg.arboreum_cottongen_reftransV1_0021779
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length382
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr6chromosomeg.arboreum_cottongen_reftransV1_0021779:1..382 .
Chr6:50549449..50549984 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A0B0PVV8_GOSAR (MND1-interacting 1-like protein OS=Gossypium arboreum GN=F383_12190 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 7.408e-33
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:   41 MGCTRDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCTRDKHIRSARRTRSVKHETDPCCLLDKSSISKSILESGIKPLSYHLGVNDSTQSPNLNPNNNANANFNDHGWGYCTEEELEEILLKNLEFLYNEAITKLISLGYDEDVALK
Sbjct:    1 MGCTRDKHIRSARRTRSVKHETDPCCLLDKSSISKSILESGIKPLSYHLGVNDSTQSPNLNPNNNANANFNDHGWGYCTEEELEEILLKNLEFLYNEAITKLISLGYDEDVALK 114          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A0D2T558_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G227600 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.969e-32
Identity = 112/114 (98.25%), Postives = 113/114 (99.12%), Query Frame = 2
Query:   41 MGCTRDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCTRDKHIRSARRTRSVKHETDPCCLLDK+SISKSILESGIKPLSYHLGVNDSTQ PNLNPNNNANANFNDHGWGYCTEEELEEILLKNLEFLYNEAITKLISLGYDEDVALK
Sbjct:    1 MGCTRDKHIRSARRTRSVKHETDPCCLLDKASISKSILESGIKPLSYHLGVNDSTQCPNLNPNNNANANFNDHGWGYCTEEELEEILLKNLEFLYNEAITKLISLGYDEDVALK 114          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A061G391_THECC (RING/U-box superfamily protein isoform 2 OS=Theobroma cacao GN=TCM_015744 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.050e-25
Identity = 97/115 (84.35%), Postives = 108/115 (93.91%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIRS RR+RSVK E DPCCLLDK+SISKSILESG+KPLSY LG+NDSTQSPN NPNNN+N NF+DHGWGYCTEE+LEEILLKNLEFLYNEAI+KL++LGYDEDVALK
Sbjct:    1 MGCTVREKHIRSTRRSRSVKPEFDPCCLLDKASISKSILESGLKPLSYPLGLNDSTQSPNPNPNNNSNTNFDDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALK 115          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A061G2E4_THECC (RING/U-box superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_015744 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.603e-24
Identity = 97/115 (84.35%), Postives = 108/115 (93.91%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIRS RR+RSVK E DPCCLLDK+SISKSILESG+KPLSY LG+NDSTQSPN NPNNN+N NF+DHGWGYCTEE+LEEILLKNLEFLYNEAI+KL++LGYDEDVALK
Sbjct:    1 MGCTVREKHIRSTRRSRSVKPEFDPCCLLDKASISKSILESGLKPLSYPLGLNDSTQSPNPNPNNNSNTNFDDHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALK 115          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A067E7U2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g005057mg PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.349e-23
Identity = 85/115 (73.91%), Postives = 97/115 (84.35%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIR+ RRTRSVK E DPCC LDK+SISKSILESG+KPLSYHLG+ND + + N N +        DHGWGYCTEE+LEEILLKNLEFLYNEAI+KL++LGYDEDVALK
Sbjct:    1 MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNAD--------DHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALK 107          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A067EIV1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g005057mg PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.237e-22
Identity = 85/115 (73.91%), Postives = 97/115 (84.35%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIR+ RRTRSVK E DPCC LDK+SISKSILESG+KPLSYHLG+ND + + N N +        DHGWGYCTEE+LEEILLKNLEFLYNEAI+KL++LGYDEDVALK
Sbjct:    1 MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNAD--------DHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALK 107          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: V4VCA6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10030828mg PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.237e-22
Identity = 85/115 (73.91%), Postives = 97/115 (84.35%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIR+ RRTRSVK E DPCC LDK+SISKSILESG+KPLSYHLG+ND + + N N +        DHGWGYCTEE+LEEILLKNLEFLYNEAI+KL++LGYDEDVALK
Sbjct:    1 MGCTVREKHIRTTRRTRSVKPEFDPCCYLDKASISKSILESGLKPLSYHLGLNDPSHNSNPNAD--------DHGWGYCTEEQLEEILLKNLEFLYNEAISKLVALGYDEDVALK 107          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A0D2QV96_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G180700 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.508e-18
Identity = 86/116 (74.14%), Postives = 97/116 (83.62%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETD-PCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KH RS RRTRSVK +TD PCC++DK S+SKSILESG+K LSYHL +NDSTQSPN N N +      DHG GYCTEE+LEE LLKNLEFLYNEAI+KL+SLGYDEDVALK
Sbjct:    1 MGCTVREKH-RSTRRTRSVKPDTDHPCCVIDKDSVSKSILESGLKSLSYHLSLNDSTQSPNPNHNTSNTNFD-DHGLGYCTEEQLEEFLLKNLEFLYNEAISKLVSLGYDEDVALK 114          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: B9S1H3_RICCO (Synaptonemal complex protein, putative OS=Ricinus communis GN=RCOM_0865020 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.832e-17
Identity = 69/115 (60.00%), Postives = 80/115 (69.57%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIR+ RR RS K E DPCC     S S         PL+YHLG++D T +     ++NAN    D+GWGYCTEE+LEEILLKNLEFLY EAI KL+SLGYDED ALK
Sbjct:   47 MGCTVREKHIRTNRRARSAKPEFDPCCYASSISKSILESGLK--PLAYHLGLHDPTHTNPNPNSSNANLE--DNGWGYCTEEQLEEILLKNLEFLYKEAIAKLVSLGYDEDTALK 157          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Match: A0A067K231_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22319 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.637e-16
Identity = 66/115 (57.39%), Postives = 77/115 (66.96%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDPCCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KHIR+ RR RS K E DPCC     S S         PL+YHLG++D   +     +N       D+GWGYCTEE+LEEILLKNLEFLY EAI+KLI+LGYDED ALK
Sbjct:    1 MGCTFREKHIRTNRRARSTKPEFDPCCYASSISKSILESGLK--PLAYHLGLHDPNHTNLSPNSNGNLD---DNGWGYCTEEQLEEILLKNLEFLYKEAISKLIALGYDEDTALK 110          
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy Swiss-Prot
Match: MIP1_ARATH (MND1-interacting protein 1 OS=Arabidopsis thaliana GN=MIP1 PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 7.140e-7
Identity = 55/116 (47.41%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   41 MGCT-RDKHIRSARRTRSVKHETDP-CCXXXXXXXXXXXXXXXXXPLSYHLGVNDSTQSXXXXXXXXXXXXXXDHGWGYCTXXXXXXXXXXXXXXXYNEAITKLISLGYDEDVALK 382
            MGCT R+KH++  RR ++    +DP  C ++K ++S+SI+E+    L YH G+ DS         N+   N  ++ W YCTEE LEEILLK+LEFLYN+A++KL+ LGY+E VALK
Sbjct:    1 MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVEN----LVYHPGLTDSGS----VNLNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALK 108          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PVV8_GOSAR7.408e-33100.00MND1-interacting 1-like protein OS=Gossypium arbor... [more]
A0A0D2T558_GOSRA3.969e-3298.25Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061G391_THECC6.050e-2584.35RING/U-box superfamily protein isoform 2 OS=Theobr... [more]
A0A061G2E4_THECC3.603e-2484.35RING/U-box superfamily protein isoform 1 OS=Theobr... [more]
A0A067E7U2_CITSI4.349e-2373.91Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067EIV1_CITSI1.237e-2273.91Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4VCA6_9ROSI1.237e-2273.91Uncharacterized protein OS=Citrus clementina GN=CI... [more]
A0A0D2QV96_GOSRA2.508e-1874.14Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9S1H3_RICCO1.832e-1760.00Synaptonemal complex protein, putative OS=Ricinus ... [more]
A0A067K231_JATCU1.637e-1657.39Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0021779 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MIP1_ARATH7.140e-747.41MND1-interacting protein 1 OS=Arabidopsis thaliana... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10044:SF133MND1-INTERACTING PROTEIN 1coord: 1..114
NoneNo IPR availablePANTHERPTHR10044INHIBITOR OF APOPTOSIScoord: 1..114

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0021779 ID=g.arboreum_cottongen_reftransV1_0021779|Name=g.arboreum_cottongen_reftransV1_0021779|organism=Gossypium arboreum|type=contig|length=382bp
AACCCATATTCACCTAAATCTCGGGAAAAAACACAAACAGATGGGTTGCA
CTAGAGACAAGCATATACGGTCGGCCCGAAGGACCCGATCGGTGAAACAC
GAAACCGATCCTTGCTGTCTTCTTGACAAATCTTCGATATCCAAATCCAT
ACTTGAATCGGGTATTAAACCCTTGAGTTACCATTTGGGTGTAAATGATT
CGACCCAAAGCCCTAATCTTAACCCTAATAACAACGCCAATGCTAATTTT
AATGATCATGGTTGGGGGTATTGCACTGAGGAAGAATTAGAGGAAATTTT
GTTGAAAAACCTGGAATTTTTGTACAATGAAGCGATAACTAAGCTTATAT
CGTTAGGTTACGATGAGGATGTTGCATTAAAG
back to top