g.arboreum_cottongen_reftransV1_0021584, g.arboreum_cottongen_reftransV1_0021584 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0021584
Unique Nameg.arboreum_cottongen_reftransV1_0021584
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1262
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr3chromosomeg.arboreum_cottongen_reftransV1_0021584:1..1262 .
Chr3:382984..390828 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A0D2RSD4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G025600 PE=4 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 1.803e-178
Identity = 264/268 (98.51%), Postives = 266/268 (99.25%), Query Frame = 3
Query:  114 MEQVAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            MEQV GEREAEEFT+VARKPYF LPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSK+LEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW
Sbjct:    1 MEQVVGEREAEEFTVVARKPYFGLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKLLEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW 268          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A0D2QY37_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G025600 PE=4 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 7.190e-175
Identity = 264/279 (94.62%), Postives = 266/279 (95.34%), Query Frame = 3
Query:  114 MEQVAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDE-----------IYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            MEQV GEREAEEFT+VARKPYF LPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDE           IYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSK+LEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW
Sbjct:    1 MEQVVGEREAEEFTVVARKPYFGLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDENCTSLYSICGQIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKLLEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW 279          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A061GQ31_THECC (Metaxin-related isoform 1 OS=Theobroma cacao GN=TCM_039342 PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 1.519e-152
Identity = 229/268 (85.45%), Postives = 246/268 (91.79%), Query Frame = 3
Query:  114 MEQVAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            MEQV   REAEEFTLV RKPYFDLPTACP+CLP++IYLKLAH PF L FNS++PDSDQIPYVESGTYVAYNNEN GV+E LK+DGIVDLDSEFQS PDW+S++AMI+SWLADA+ YELWVG+DGRSA KIYYSDLSWPIGKVL LKQVY VKQRLGITKDNAE REDEIYRRAKIAYGALST+LGEQNFLFDDRPSSLDATFLGH LVTLH LP++SVLRSK+LEHDNIVRYAEKLK ELIESGSSSSGPQF SVPSSS PRK  SNW
Sbjct:    1 MEQVQA-REAEEFTLVTRKPYFDLPTACPLCLPVYIYLKLAHLPFHLEFNSVYPDSDQIPYVESGTYVAYNNENGGVIERLKQDGIVDLDSEFQSVPDWISMKAMISSWLADAIMYELWVGSDGRSANKIYYSDLSWPIGKVLLLKQVYIVKQRLGITKDNAEQREDEIYRRAKIAYGALSTRLGEQNFLFDDRPSSLDATFLGHALVTLHVLPESSVLRSKLLEHDNIVRYAEKLKMELIESGSSSSGPQFHSVPSSSAPRKDSSNW 267          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A061GR24_THECC (Metaxin-related isoform 2 OS=Theobroma cacao GN=TCM_039342 PE=4 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 9.284e-141
Identity = 219/268 (81.72%), Postives = 235/268 (87.69%), Query Frame = 3
Query:  114 MEQVAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            MEQV   REAEEFTLV RKPYFDLPTACP+CLP++IYLKLAH PF L FNS++PDSDQIPYVESGTYVAYNNEN GV+E LK+DGIVDLDSEFQS PDW+S++AMI+SWLADA+ YELWVG+DGRSA KIYYSDLSWPIGKVL LKQVY VKQRLGITKDNAE REDEIYRRAKIAYGALST           RPSSLDATFLGH LVTLH LP++SVLRSK+LEHDNIVRYAEKLK ELIESGSSSSGPQF SVPSSS PRK  SNW
Sbjct:    1 MEQVQA-REAEEFTLVTRKPYFDLPTACPLCLPVYIYLKLAHLPFHLEFNSVYPDSDQIPYVESGTYVAYNNENGGVIERLKQDGIVDLDSEFQSVPDWISMKAMISSWLADAIMYELWVGSDGRSANKIYYSDLSWPIGKVLLLKQVYIVKQRLGITKDNAEQREDEIYRRAKIAYGALST-----------RPSSLDATFLGHALVTLHVLPESSVLRSKLLEHDNIVRYAEKLKMELIESGSSSSGPQFHSVPSSSAPRKDSSNW 256          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A0D2QQR5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G025600 PE=4 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 2.217e-135
Identity = 215/222 (96.85%), Postives = 216/222 (97.30%), Query Frame = 3
Query:  252 LSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            L FN     SDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSK+LEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW
Sbjct:    4 LFFNKFL--SDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKLLEHDNIVRYAEKLKTELIESGSSSSGPQFRSVPSSSTPRKGPSNW 223          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A067LDZ2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04566 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 8.407e-128
Identity = 192/262 (73.28%), Postives = 222/262 (84.73%), Query Frame = 3
Query:  135 REAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXX-XXXXXXXXXTPRKGPSNW 917
            RE EE+TLVARKP F LPTACPICLP++IYLKLA FPFRL FNS +PDSDQIPYVESG YVAYNNEN GV++ LK+DGIV+LD+EF S P+W+S++AMINSWL DA+TYELW+G+ G SA+K YYSDL W IGK LF+KQ Y+VKQRLGITK+NAE RE EIY+RAKIAY ALST+LGEQ FLFDDR SSLDA FLGHVL T+ ALP+TSVLRS +LEH N+VRYAEK KT  +ES SSSS   +F    SSSTPR+GPSN+
Sbjct:    5 REREEYTLVARKPCFGLPTACPICLPVYIYLKLARFPFRLDFNSTYPDSDQIPYVESGVYVAYNNENGGVIQRLKEDGIVNLDAEFCSIPEWISLKAMINSWLLDAITYELWLGSAGSSAFKSYYSDLPWLIGKALFVKQTYTVKQRLGITKENAERREVEIYKRAKIAYAALSTRLGEQEFLFDDRASSLDAFFLGHVLYTIQALPETSVLRSSLLEHGNLVRYAEKFKTNFLESDSSSSSIPRFHPESSSSTPRRGPSNY 266          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: V4UK35_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008916mg PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 2.641e-125
Identity = 191/268 (71.27%), Postives = 232/268 (86.57%), Query Frame = 3
Query:  114 MEQVAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSNW 917
            ME+V    E E+FTLV RKPYF LPTACPICLP++IYLK A  PF L+F+S +PDSD IPYVES TYVA NNEN GV+ECLKKDGIVDLD+ +QS P+W+S++A+I+SWL +AL YELWVG+DG S  KIYYSDL+WPIGKVLFL+QV +VKQ+LGITK+N++ RE+EIY+RA IAY ALST+LGE++FLF++RPSS+DA  L HVLVTLHALP+TS+L+SK+LEH N+VRYAEKLKTE +E+GSSSS P F S PSSSTPRKGPS+W
Sbjct:    1 MERV---NEREDFTLVTRKPYFGLPTACPICLPVYIYLKFARLPFHLAFDSTYPDSDIIPYVESATYVACNNENGGVIECLKKDGIVDLDNGYQSVPEWISMKALISSWLEEALIYELWVGSDGNSVRKIYYSDLAWPIGKVLFLQQVRTVKQQLGITKENSDRREEEIYKRASIAYRALSTRLGEESFLFENRPSSVDAILLAHVLVTLHALPETSLLKSKLLEHGNLVRYAEKLKTEFVEAGSSSSIPPFPSDPSSSTPRKGPSHW 265          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: W9SGI3_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_009206 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.454e-121
Identity = 176/264 (66.67%), Postives = 215/264 (81.44%), Query Frame = 3
Query:  123 VAGEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXTPRKGPSN 914
            + GER  E +TLV R+P + LPTACP CLPL++YL+ A+ PF L FN ++PDSDQIPY+ESG YVAYNNE  GV+E +K DGI+DLD+E  S PDW+S +AM+ SWLADA+ YELWV +DG SA KIY SDL WPIGKVLFLKQ Y+VKQ+LGI KDNAE +E+EIYR+A IAYGALSTKLG+QNFLF++RPSSLDA  LG  L+T+HALP+TSVLRSK+LEHDN+VRYAE++KTE +++G S S P   +  SSST RKG S 
Sbjct:    1 MEGERARESYTLVVRRPCYGLPTACPECLPLYLYLRFANVPFHLDFNLVYPDSDQIPYIESGDYVAYNNEKGGVIERIKNDGIIDLDNELYSVPDWISTKAMLTSWLADAIKYELWVASDGSSAQKIYCSDLPWPIGKVLFLKQAYNVKQQLGICKDNAEQKEEEIYRKASIAYGALSTKLGDQNFLFENRPSSLDAIVLGQALITIHALPETSVLRSKLLEHDNLVRYAERIKTEFVDTGPSISVPHLHAESSSSTSRKGQSQ 264          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A0A0LU72_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G423330 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 3.416e-117
Identity = 175/265 (66.04%), Postives = 213/265 (80.38%), Query Frame = 3
Query:  135 REAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXX----XXXXXXXXXXXXXXTPRKGPSNW 917
            R  E  TLV RKP F+LPT CP  LP++IYL+LA+  F L FN I+P+SD IPYVE+G YVAYNNE  GV+ECL++DGIVDLDSEF S P+WVS ++M++SWLADA+ YELW+GTDG SA K+YYSDL WPIGKVLFLK++YSVK +LGI K+NAE RE++IYR A +AYGALST+LGEQNFLF++RPSSLDA  LGH+L TL  LP+TSVLRSK+LEH N+VRYAEK  TEL+E G+      S  +  +  SSSTPR+GP NW
Sbjct:    4 RAEEGLTLVVRKPCFNLPTGCPDSLPVYIYLRLANLHFHLDFNLIYPESDIIPYVETGNYVAYNNEKGGVIECLRQDGIVDLDSEFLSLPEWVSAKSMVSSWLADAVMYELWLGTDGASASKVYYSDLPWPIGKVLFLKKLYSVKLQLGINKENAERREEQIYRNANLAYGALSTRLGEQNFLFENRPSSLDALVLGHLLFTLQVLPETSVLRSKLLEHSNLVRYAEKYMTELVEVGTSSSPLPSSSRSSTGASSSTPRRGPYNW 268          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Match: A0A059CL74_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_C00132 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 3.617e-116
Identity = 180/267 (67.42%), Postives = 214/267 (80.15%), Query Frame = 3
Query:  123 VAGEREAE-EFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIEXXXXXXXXXXXXXXXXXT-PRKGPSNW 917
            + G  E E EFTLVARKP F LPTACP CLP+FIYLKLA  PFRL FN  FPDSDQ+PYVESG YVAYNNE  GV+E LK+DGIVDLD E +S P+++S +AMI+SWL +A+ YELWVG+DG SA+ IYY+DL WP+GK+L+LKQ+ SVKQ LGITKDNAE RE EIYRRAKIAY ALST LGE N+ F  RPSSLDA FLGH L TL ALP+ S+LR+++LEH N+VRYAEK K+E +E+GSSSS        SS++ PR+GPS+W
Sbjct:    1 MEGASETEREFTLVARKPCFGLPTACPHCLPVFIYLKLAKIPFRLDFNLTFPDSDQVPYVESGAYVAYNNEKGGVIESLKEDGIVDLDLELRSVPEFISSKAMISSWLEEAIIYELWVGSDGTSAHNIYYADLPWPVGKLLYLKQIRSVKQHLGITKDNAERREAEIYRRAKIAYEALSTMLGE-NYFFFGRPSSLDAFFLGHALFTLQALPEASLLRNRLLEHGNLVRYAEKHKSECLEAGSSSSSDMHFPPSSSASAPRQGPSHW 266          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: MTX_ARATH (Mitochondrial outer membrane import complex protein METAXIN OS=Arabidopsis thaliana GN=MTX1 PE=1 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 7.141e-113
Identity = 161/237 (67.93%), Postives = 191/237 (80.59%), Query Frame = 3
Query:  129 GEREAEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGIVDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIE 839
            G++E   +TLVARKP FDLPTACP CLP +IYLKLA  PF L+FNS FPDSD++PY ES TYVAYNNE+ GV+E LKKDGIV+LDS+ QS  D++S++A+I SWL +ALTYE+WVGT+G S  KIYYSDL W I KVLF KQ Y  K RLGITK+NAE RE +IY+RA  AY ALST+LGEQ FLF+DRPSSLDA  L H+L  + ALP TSVLR K+LEH N+VRYAEKLK+E +E
Sbjct:    3 GDQETNVYTLVARKPSFDLPTACPNCLPAYIYLKLAQLPFELAFNSTFPDSDELPYFESDTYVAYNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSDLPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYKRASEAYEALSTRLGEQKFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLE 239          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: MTX2_HUMAN (Metaxin-2 OS=Homo sapiens GN=MTX2 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.952e-9
Identity = 51/221 (23.08%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  207 LPLFIYLKLAHFPFRLSFNS---IFPDSDQIPYVESGTYVAYNNENSGVVECLKKDG--IVDLDSEFQSAPDWVSIQAMINSWLADALTYELWV--GTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRL---GITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIE 839
            L +  +L++ + P ++   +       S ++P++  G  V   +E   +V+ +K  G  + D   E Q A +  +   ++N+ L  A  Y  W    T G   +  Y S   WP+  +L  ++ + VK+++   G  K       D++         ALS +LG Q + F+ +P+ LDA   GH+   L        L  KV  + N++ +  +++    E
Sbjct:   42 LAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFIHVGNQVV--SELGPIVQFVKAKGHSLSDGLEEVQKA-EMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTL----DQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFE 255          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: MTX2_PIG (Metaxin-2 OS=Sus scrofa GN=MTX2 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 6.538e-9
Identity = 51/219 (23.29%), Postives = 97/219 (44.29%), Query Frame = 3
Query:  207 LPLFIYLKLAHFPFRLSFNS---IFPDSDQIPYVESGTYVAYNNENSGVVECLKKDG--IVDLDSEFQSAPDWVSIQAMINSWLADALTYELWV--GTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRL-GITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIE 839
            L +  +L++ + P ++   +       S ++P++  G  V   +E   +V+ +K  G  + D   E Q A +  +   ++N+ L  A  Y  W    T G   +  Y S   WP+  +L  ++ + VK+++  I   N     D++         ALS +LG Q + F+ +P+ LDA   GH+   L        L  KV  + N++ +  +++    E
Sbjct:   42 LAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFIHVGNQVV--SELGPIVQFVKAKGHSLSDGLDEVQKA-EMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGN--KTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFE 255          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: MTX2_MOUSE (Metaxin-2 OS=Mus musculus GN=Mtx2 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.354e-8
Identity = 51/219 (23.29%), Postives = 97/219 (44.29%), Query Frame = 3
Query:  207 LPLFIYLKLAHFPFRLSFNS---IFPDSDQIPYVESGTYVAYNNENSGVVECLKKDG--IVDLDSEFQSAPDWVSIQAMINSWLADALTYELWV--GTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRL-GITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTELIE 839
            L +  +L++ + P ++   +       S ++P++  G  V   +E   +V+ +K  G  + D   E Q A +  +   ++N+ L  A  Y  W    T G      Y S   WP+  +L  ++ + VK+++  I   N     D++         ALS +LG Q + F+ +P+ LDA   GH+   L     +  L  KV  + N++ +  +++    E
Sbjct:   42 LAVQAFLQMCNLPVKVVCRANAEYMSPSGKVPFIHVGNQVV--SELGPIVQFVKAKGHSLSDGLDEVQKA-EMKAYMELVNNMLLTAELYLQWCDEATVGEITIARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGN--KTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTSDELSEKVKNYSNLLAFCRRIEQHYFE 255          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: FAXC_RAT (Failed axon connections homolog OS=Rattus norvegicus GN=Faxc PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.419e-8
Identity = 57/234 (24.36%), Postives = 99/234 (42.31%), Query Frame = 3
Query:  168 KPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNEN-SG---VVECLKKDGIVDLDSEFQSAPDWVS--IQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDN------AEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTEL 833
            +P   +P+  P CL +  YL++A  P++  F        ++P++E      YNNE  SG   +++ L++   V+L+         VS  +  M+       L Y  WV     +   +  S    P   +L     +  K   GI K            E+EIY   +    +L+  LG++ ++   + S+LDAT  GH+   +  LP T   R    E  N+  Y E+++ + 
Sbjct:  107 RPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIE------YNNEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGG-PFSNLLRWVVCHITK---GIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKF 330          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: FAXC_MOUSE (Failed axon connections homolog OS=Mus musculus GN=Faxc PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.620e-8
Identity = 57/234 (24.36%), Postives = 99/234 (42.31%), Query Frame = 3
Query:  168 KPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNEN-SG---VVECLKKDGIVDLDSEFQSAPDWVS--IQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDN------AEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTEL 833
            +P   +P+  P CL +  YL++A  P++  F        ++P++E      YNNE  SG   +++ L++   V+L+         VS  +  M+       L Y  WV     +   +  S    P   +L     +  K   GI K            E+EIY   +    +L+  LG++ ++   + S+LDAT  GH+   +  LP T   R    E  N+  Y E+++ + 
Sbjct:  107 RPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIE------YNNEKVSGTEFIIDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGG-PFSNLLRWVVCHITK---GIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKF 330          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: MTX3_DANRE (Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 1.240e-7
Identity = 60/240 (25.00%), Postives = 99/240 (41.25%), Query Frame = 3
Query:  141 AEEFTLVARKPYFDLPTACPICLPLFIYLKLAHFPFRLSF-----NSIFPDSDQIPYVESGTYVAYNNENSGVVECLKKDGI-VDLDSEFQSAPDWVSIQAMINSWLADALTYELWVGTDGRS--AYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKD-----NAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKL 821
            AE   L+     +DLP+     L +  Y K A     + F      +I     QI Y   GT V    E + ++  L+K     D +   +   D ++  A++   L  AL +  WV  +  +      + S   +P+   +  +Q      R+ +TK      N    E +IY  AK     LS +LG  NF F D P+SLDA   GH+   + A   +  L+  + + DN+ ++   +
Sbjct:    2 AEPIELLCWGGDWDLPSVQTDSLTVLAYAKFAGAELTVKFVDWTWRTITASVPQIHY--EGTTVT---EPTQILNFLRKQRFNADFELTAKQGADTMAYIALLEEKLRPALLHTFWVDAENYANLTRPWFTSHSPFPLNFFVPGRQASLALSRILLTKAESPLLNITEVEGKIYSEAKECLNLLSHRLGNFNFFFGDTPTSLDAFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTI 236          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: FAXC_HUMAN (Failed axon connections homolog OS=Homo sapiens GN=FAXC PE=2 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 1.679e-7
Identity = 55/234 (23.50%), Postives = 99/234 (42.31%), Query Frame = 3
Query:  168 KPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNEN-SG---VVECLKKDGIVDLDSEFQSAPDWVS--IQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDN------AEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLKTEL 833
            +P   +P+  P CL +  YL++A  P++  F        ++P++E      YN+E  SG   +++ L++   V+L+         +S  +  M+       L Y  WV     +   +  S    P   +L     +  K   GI K            E+EIY   +    +L+  LG++ ++   + S+LDAT  GH+   +  LP T   R    E  N+  Y E+++ + 
Sbjct:  107 RPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKLSAQGKMPWIE------YNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGG-PFSNLLRWVVCHITK---GIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKF 330          
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Match: FAXC_XENTR (Failed axon connections homolog OS=Xenopus tropicalis GN=faxc PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.959e-7
Identity = 50/225 (22.22%), Postives = 95/225 (42.22%), Query Frame = 3
Query:  168 KPYFDLPTACPICLPLFIYLKLAHFPFRLSFNSIFPDSDQIPYVESGTYVAYNNEN-SG---VVECLKKDGIVDLDSEFQSAPDWVS--IQAMINSWLADALTYELWVGTDGRSAYKIYYSDLSWPIGKVLFLKQVYSVKQRLGITKDNAEHREDEIYRRAKIAYGALSTKLGEQNFLFDDRPSSLDATFLGHVLVTLHALPDTSVLRSKVLEHDNIVRYAEKLK 824
            +P   +P+  P CL +  YL++A  P++  F+       ++P++E      YN+   SG   +++ L++   V+L+         VS  +  M+       L Y  WV     +   +  +     + K +       + +R    +      E+EIYR  +    +L+  LG++ +L   + S+LDAT  GH+   L     T        E  N+  Y E+++
Sbjct:  106 RPNNGVPSLSPFCLKIETYLRMADLPYQNYFDGKLSPQGKMPWIE------YNHTRVSGTEFIIDFLEEKLGVNLNKHLNPHQRAVSRAVTKMVEEHFYWTLAYCQWVENLDETQKMLNITGPLSDLLKWILCHLTKGIVKREMYGQGIGRFSEEEIYRLMEKDMRSLAGLLGDKKYLMGPKFSTLDATVFGHIANALWGTQGTYKEEGIAGELINLAMYCERIR 324          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2RSD4_GOSRA1.803e-17898.51Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QY37_GOSRA7.190e-17594.62Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GQ31_THECC1.519e-15285.45Metaxin-related isoform 1 OS=Theobroma cacao GN=TC... [more]
A0A061GR24_THECC9.284e-14181.72Metaxin-related isoform 2 OS=Theobroma cacao GN=TC... [more]
A0A0D2QQR5_GOSRA2.217e-13596.85Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067LDZ2_JATCU8.407e-12873.28Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
V4UK35_9ROSI2.641e-12571.27Uncharacterized protein OS=Citrus clementina GN=CI... [more]
W9SGI3_9ROSA1.454e-12166.67Uncharacterized protein OS=Morus notabilis GN=L484... [more]
A0A0A0LU72_CUCSA3.416e-11766.04Uncharacterized protein OS=Cucumis sativus GN=Csa_... [more]
A0A059CL74_EUCGR3.617e-11667.42Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0021584 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MTX_ARATH7.141e-11367.93Mitochondrial outer membrane import complex protei... [more]
MTX2_HUMAN3.952e-923.08Metaxin-2 OS=Homo sapiens GN=MTX2 PE=1 SV=1[more]
MTX2_PIG6.538e-923.29Metaxin-2 OS=Sus scrofa GN=MTX2 PE=2 SV=1[more]
MTX2_MOUSE1.354e-823.29Metaxin-2 OS=Mus musculus GN=Mtx2 PE=1 SV=1[more]
FAXC_RAT2.419e-824.36Failed axon connections homolog OS=Rattus norvegic... [more]
FAXC_MOUSE2.620e-824.36Failed axon connections homolog OS=Mus musculus GN... [more]
MTX3_DANRE1.240e-725.00Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2[more]
FAXC_HUMAN1.679e-723.50Failed axon connections homolog OS=Homo sapiens GN... [more]
FAXC_XENTR5.959e-722.22Failed axon connections homolog OS=Xenopus tropica... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033468Metaxin, glutathione S-transferase domainPFAMPF17171GST_C_6coord: 197..259
e-value: 3.7E-16
score: 58.5
IPR017410Mitochondrial outer membrane transport complex protein, metaxinPIRSFPIRSF038150Metaxincoord: 33..349
e-value: 4.0E-100
score: 332.5
IPR012336Thioredoxin-like foldPFAMPF17172GST_N_4coord: 53..145
e-value: 1.6E-16
score: 60.7
NoneNo IPR availablePANTHERPTHR12289:SF38METAXIN-2coord: 18..348
NoneNo IPR availablePANTHERPTHR12289METAXIN RELATEDcoord: 18..348
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 317..336
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 337..353
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..316
NoneNo IPR availableTMHMMTMhelixcoord: 317..336

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0021584 ID=g.arboreum_cottongen_reftransV1_0021584|Name=g.arboreum_cottongen_reftransV1_0021584|organism=Gossypium arboreum|type=contig|length=1262bp
AAACGCTTTGTTAAACCCCTACTCTCAAAACTCTTTTCAGCTTGCTCTGG
TATTTTTACCCATCGGAGCAAATTACAAACAGCCATAGCTGCTTAGTGAA
AAAGAAAAAGAAAATGGAGCAAGTGGCGGGTGAAAGGGAAGCCGAAGAGT
TCACACTGGTCGCAAGGAAGCCTTACTTCGATCTCCCAACTGCGTGCCCT
ATTTGTTTGCCGCTTTTCATTTATCTCAAGCTTGCCCACTTTCCCTTTCG
TTTATCTTTCAATTCAATCTTCCCTGATTCAGATCAAATTCCTTATGTTG
AATCTGGTACTTACGTTGCCTACAACAACGAGAATAGTGGGGTTGTTGAG
TGTTTAAAGAAAGATGGTATCGTTGATCTGGACTCTGAATTCCAATCTGC
CCCAGATTGGGTATCGATACAAGCTATGATTAACTCTTGGTTAGCTGATG
CATTGACGTACGAACTATGGGTGGGTACCGATGGAAGATCAGCCTACAAG
ATTTATTATTCTGATCTTTCATGGCCAATAGGAAAAGTTCTTTTCCTAAA
GCAAGTGTATAGTGTTAAACAACGTCTTGGAATTACTAAAGACAATGCCG
AACACAGAGAAGATGAGATTTACAGGAGAGCAAAAATTGCTTATGGTGCT
CTATCTACTAAGTTAGGAGAACAGAACTTCCTCTTTGATGATAGGCCATC
AAGCTTGGATGCAACTTTTCTCGGACATGTTCTTGTCACCCTTCATGCAC
TACCTGACACGTCAGTGCTCCGAAGCAAAGTCTTGGAGCATGACAATATT
GTCAGATATGCCGAAAAACTTAAAACGGAGTTGATAGAGTCTGGTTCATC
ATCTTCTGGTCCACAATTTCGCTCAGTCCCTTCATCGTCAACTCCGAGAA
AAGGTCCCTCAAATTGGAGTTCAAAGCCGAAGAGCAAGCCAAAAAGGGAG
AAAACAGAGGAGGAGAAAACTTTTAAGAGGAGGGCAAAATATTTTCTAGC
TGCACAGCTACTTGCGGTTCTGCTTTTCCTCTCCATGATGGGCGGTTATG
ATTCTGGTGACCTGGAGCTCGACGACGAAGATGAAGGCATCTCTTTCAAT
TGAAACAAATCTCTCAGTTACCGGGTACTCATTACTGACATTTTTCCCAT
TATTAGTGACAATGTTAGTGATCTGTTGAGGTTGAGCTATTAGTATTTGC
ATTAACATTGTGGTAAAAAATAAGAACATACATTTAAAGATTTGATTTAT
ACAATATTTACG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR033468Metaxin_GST
IPR017410Metaxin
IPR012336Thioredoxin-like_fold
Vocabulary: Biological Process
TermDefinition
GO:0006626protein targeting to mitochondrion
Vocabulary: Cellular Component
TermDefinition
GO:0005741mitochondrial outer membrane