g.arboreum_cottongen_reftransV1_0010677, g.arboreum_cottongen_reftransV1_0010677 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010677
Unique Nameg.arboreum_cottongen_reftransV1_0010677
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1094
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr6chromosomeg.arboreum_cottongen_reftransV1_0010677:1..1094 .
Chr6:18322529..18324905 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: A0A0D2TYX8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G072400 PE=4 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 282/287 (98.26%), Postives = 283/287 (98.61%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQ PG TTTPGSG QPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIEELEQLLLLNSDRNSINHASSLLQSLPKVMSNVHDFF+HVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQP TQV
Sbjct:   70 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQAPGPTTTPGSGAQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIEELEQLLLLNSDRNSINHASSLLQSLPKVMSNVHDFFIHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPSTQV 356          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: A0A061DHM3_THECC (Hydroxyproline-rich glycoprotein family protein OS=Theobroma cacao GN=TCM_000528 PE=4 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 263/287 (91.64%), Postives = 273/287 (95.12%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TNDKTPASYSTKWADLHPDSQK LLQIEERILEYRDESQRLDQC+RLYDSSVSNEGFELDASHIVQELGG+STAME+QKALLQELM+TVKDMLRNTEVAVRSFMMLRPRF+HSN  GASN TAPSQ PGATTTPGS  QP+AAS++PVFDFYHGLPKKPS FLQ+T+ARFEKYLGECRQWIEELEQLLL NSDRNSINH SSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLAD R RGDVNDPFLEADRRETAKQEA AKRVHPTLHLPANSQP TQV
Sbjct:   70 TNDKTPASYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVSNEGFELDASHIVQELGGVSTAMEQQKALLQELMATVKDMLRNTEVAVRSFMMLRPRFLHSNIAGASNTTAPSQAPGATTTPGSSAQPSAASILPVFDFYHGLPKKPSLFLQHTIARFEKYLGECRQWIEELEQLLLFNSDRNSINHTSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADQRRRGDVNDPFLEADRRETAKQEAVAKRVHPTLHLPANSQPSTQV 356          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: I1J922_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 1.958e-171
Identity = 246/287 (85.71%), Postives = 263/287 (91.64%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TND+TPASYST WADLHPDSQK LLQIEERILEYRDESQRLDQC+RLYDSSVSN+GFELDA HIVQELGGI+TAMERQK LLQELMSTVKDMLRNTEVAVRSFMMLRPRF+H  +GG S+ATAPSQ PGAT  P S  QPT AS+VPVFDFY GLPKKPSPFLQ TV RFEKYLGEC QWIEELEQLLLL+S+RN+  + SSLLQSLPKVM+NVHDFFVHVAAKVESIHQYIESMK+AYLAD R RG+VNDPFLEADRRETA+QEAA+KRVHPTLHLPANSQP TQV
Sbjct:   57 TNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGFELDAGHIVQELGGINTAMERQKTLLQELMSTVKDMLRNTEVAVRSFMMLRPRFLHP-SGGTSSATAPSQTPGATIAPSSSSQPTTASIVPVFDFYSGLPKKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLDSERNASANGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRRRGEVNDPFLEADRRETARQEAASKRVHPTLHLPANSQPSTQV 342          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: A0A0B2RUQ7_GLYSO (Peroxidase A OS=Glycine soja GN=glysoja_003306 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 2.280e-171
Identity = 246/287 (85.71%), Postives = 263/287 (91.64%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TND+TPASYST WADLHPDSQK LLQIEERILEYRDESQRLDQC+RLYDSSVSN+GFELDA HIVQELGGI+TAMERQK LLQELMSTVKDMLRNTEVAVRSFMMLRPRF+H  +GG S+ATAPSQ PGAT  P S  QPT AS+VPVFDFY GLPKKPSPFLQ TV RFEKYLGEC QWIEELEQLLLL+S+RN+  + SSLLQSLPKVM+NVHDFFVHVAAKVESIHQYIESMK+AYLAD R RG+VNDPFLEADRRETA+QEAA+KRVHPTLHLPANSQP TQV
Sbjct:   57 TNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGFELDAGHIVQELGGINTAMERQKTLLQELMSTVKDMLRNTEVAVRSFMMLRPRFLHP-SGGTSSATAPSQTPGATIAPSSNSQPTTASIVPVFDFYSGLPKKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLDSERNASANGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRRRGEVNDPFLEADRRETARQEAASKRVHPTLHLPANSQPSTQV 342          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: A0A067K6J9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_12322 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 5.122e-171
Identity = 245/287 (85.37%), Postives = 261/287 (90.94%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TN+K PA+YSTKWADLHPDSQK LLQIEERILE RDESQRLDQC+RLYDSS+SNEGFE DA  ++QELGGISTAMERQKALLQELM  VKDMLRNTE+AVRSFM+LRPRF H N GGASNAT+PSQ  GAT TPGS  QPT+AS+VPVFDFY G+PKKPSPFLQ TV RFEKYLGECRQWIEELEQLLLL+S RNS +  SSLLQSLPKVMSNVHDFFVHVA+KVESIHQYIESMKTAYLAD R RGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPA+SQP TQV
Sbjct:   66 TNEKAPANYSTKWADLHPDSQKLLLQIEERILEDRDESQRLDQCSRLYDSSISNEGFEFDAGRVIQELGGISTAMERQKALLQELMVNVKDMLRNTEMAVRSFMILRPRFFHPNAGGASNATSPSQPSGATGTPGSSSQPTSASIVPVFDFYSGVPKKPSPFLQQTVIRFEKYLGECRQWIEELEQLLLLDSGRNSSHPGSSLLQSLPKVMSNVHDFFVHVASKVESIHQYIESMKTAYLADQRRRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPASSQPSTQV 352          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: W9R2Y6_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_020279 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 2.220e-169
Identity = 246/287 (85.71%), Postives = 263/287 (91.64%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TNDKTPA+Y TKWADLHPDS K LLQIEERILEYRDESQRLDQC+RLY+SSVSN+GFE DASHIVQELGGISTAMERQK+LL ELM++VKDMLRNTEVAVRSFMMLRPRFVH N GG S ATAPSQ+PGAT  PGS  Q TA S+VPVFDFY+G+P+KPSPFLQ TVARFEKYL +CRQWIEELEQLLLL+S++NS N A SLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMK AYLAD R RGDVNDPFLEADRRETA+QEAAAKRVHPTLHLPANSQP TQV
Sbjct:  119 TNDKTPATYGTKWADLHPDSHKILLQIEERILEYRDESQRLDQCSRLYNSSVSNDGFEQDASHIVQELGGISTAMERQKSLLHELMASVKDMLRNTEVAVRSFMMLRPRFVHPNIGGGSIATAPSQLPGATVPPGSSGQSTATSIVPVFDFYNGIPRKPSPFLQQTVARFEKYLCQCRQWIEELEQLLLLDSEKNSCNGA-SLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKAAYLADQRRRGDVNDPFLEADRRETARQEAAAKRVHPTLHLPANSQPSTQV 404          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: I1LHI3_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.241e-168
Identity = 244/287 (85.02%), Postives = 263/287 (91.64%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TND+TPASYST WADLHPDSQK LLQIEERILE+RDESQRLDQC+RLYDSSVSN+GFELDA HIVQELGGI+TAMERQK LL ELMSTVKDMLRNTEVAVRSFMMLRPRF+H  +GG S+ATAPSQ PGAT  P S  QPT AS+VPVFDFY GLP+KPSPFLQ TV RFEKYLGEC QWIEELEQLLLL S+RN+ ++ SSLLQSLPKVM+NVHDFFVHVAAKVESIHQYIESMK+AYLAD RHRG+VNDPFLEADRRETA+QEAA+KRVHPTLHLPANSQP TQV
Sbjct:   71 TNDRTPASYSTNWADLHPDSQKILLQIEERILEFRDESQRLDQCSRLYDSSVSNDGFELDAGHIVQELGGINTAMERQKTLLHELMSTVKDMLRNTEVAVRSFMMLRPRFLHP-SGGTSSATAPSQTPGATIAPSSSSQPTTASIVPVFDFYSGLPRKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLESERNASSNGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRHRGEVNDPFLEADRRETARQEAASKRVHPTLHLPANSQPSTQV 356          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: K7LNA0_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 2.200e-168
Identity = 244/287 (85.02%), Postives = 263/287 (91.64%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TND+TPASYST WADLHPDSQK LLQIEERILE+RDESQRLDQC+RLYDSSVSN+GFELDA HIVQELGGI+TAMERQK LL ELMSTVKDMLRNTEVAVRSFMMLRPRF+H  +GG S+ATAPSQ PGAT  P S  QPT AS+VPVFDFY GLP+KPSPFLQ TV RFEKYLGEC QWIEELEQLLLL S+RN+ ++ SSLLQSLPKVM+NVHDFFVHVAAKVESIHQYIESMK+AYLAD RHRG+VNDPFLEADRRETA+QEAA+KRVHPTLHLPANSQP TQV
Sbjct:   71 TNDRTPASYSTNWADLHPDSQKILLQIEERILEFRDESQRLDQCSRLYDSSVSNDGFELDAGHIVQELGGINTAMERQKTLLHELMSTVKDMLRNTEVAVRSFMMLRPRFLHP-SGGTSSATAPSQTPGATIAPSSSSQPTTASIVPVFDFYSGLPRKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLESERNASSNGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRHRGEVNDPFLEADRRETARQEAASKRVHPTLHLPANSQPSTQV 356          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: G7K9F1_MEDTR (Hydroxyproline-rich glycoprotein family protein, putative OS=Medicago truncatula GN=MTR_5g018390 PE=4 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 4.879e-167
Identity = 242/287 (84.32%), Postives = 261/287 (90.94%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TNDKTPASYST WADLHPDSQKFLLQIEER+LEYRDESQRLDQC RLYDSSVSN+GFE+DASHIVQELGGISTAMERQK LLQEL S VKDMLRNTEVAVRSFM+LRPRF H  +GGAS+ATAPSQ PGATT P    QP A SMVPVFDFY GLPKKPSPFLQ T+ RFEKY+GEC QWI+ELEQLLLL S++N+ ++ SSLLQSLPKVM+NVHDFFVHVAAKVESIHQY+ESMKTAYLAD R RG+VNDPFLEADRRETA+QEAA+KRVHPTLHLPANSQP TQV
Sbjct:   68 TNDKTPASYSTNWADLHPDSQKFLLQIEERVLEYRDESQRLDQCNRLYDSSVSNDGFEVDASHIVQELGGISTAMERQKTLLQELTSAVKDMLRNTEVAVRSFMILRPRF-HYPSGGASSATAPSQTPGATT-PSLNSQPPATSMVPVFDFYSGLPKKPSPFLQQTILRFEKYIGECHQWIQELEQLLLLESEKNASSNGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYMESMKTAYLADQRRRGEVNDPFLEADRRETARQEAASKRVHPTLHLPANSQPSTQV 352          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Match: A0A059B067_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H01972 PE=4 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 6.770e-167
Identity = 239/287 (83.28%), Postives = 260/287 (90.59%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGASNATAPSQVPGATTTPGSGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPANSQPPTQV 1011
            TNDKT ASY TKWADLHPDSQK LLQIEE+ILEYR ESQ+LDQC+RLYDSSVS++GFE DASHIVQELGGIST+MERQKALLQELM+ VKDMLRNTEVAVRSFMMLRPRF+HSN G ++NATAPSQ PGAT TP S  QP + S+VPVFDFY GLPKKPSPFLQ TVARFEKYLG CRQW+EELEQLLLL+SDRN  N +SSL++SLPKV+SNVHDFFVHVAAKVESIHQYI SMKTAYLAD RHRGD NDPFLEADRRETA+QEAA++RVHPTLHLP  SQP TQV
Sbjct:   77 TNDKTSASYGTKWADLHPDSQKILLQIEEKILEYRVESQKLDQCSRLYDSSVSSDGFEHDASHIVQELGGISTSMERQKALLQELMAAVKDMLRNTEVAVRSFMMLRPRFIHSNAGSSTNATAPSQTPGATVTPSSSGQPASTSVVPVFDFYSGLPKKPSPFLQQTVARFEKYLGACRQWVEELEQLLLLDSDRNGTNLSSSLVESLPKVISNVHDFFVHVAAKVESIHQYIGSMKTAYLADQRHRGDGNDPFLEADRRETARQEAASRRVHPTLHLPPVSQPSTQV 363          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy Swiss-Prot
Match: NUP58_ARATH (Nuclear pore complex protein NUP58 OS=Arabidopsis thaliana GN=NUP58 PE=1 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.492e-138
Identity = 215/293 (73.38%), Postives = 239/293 (81.57%), Query Frame = -3
Query:  151 TNDKTPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCTRLYDSSVSNEGFELDASHIVQELGGISTAMERQKALLQELMSTVKDMLRNTEVAVRSFMMLRPRFVHSNTGGA--SNATAPSQVPGATTTPG-SGVQPTAASMVPVFDFYHGLPKKPSPFLQYTVARFEKYLGECRQWIXXXXXXXXLNSDRNSINHASSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADHRHRGDVNDPFLEADRRETAKQEAAAKRVHPTLHLPA---NSQPPTQV 1011
            TNDK PA+YSTKWADLHPDSQK LLQIEE+ILE+R ESQRLDQC+RLYDSSVS+EGFE DAS IVQELGGI+TAM+RQKA+L ELM   KDMLRN E+AVRSFMML+PRF H   GG   S  + PSQ  G    P  SG Q    + V V DFY G+PKKP+ FL  TV RFEKYL ECRQW+EELEQLL L+SD+ S  HA SLL+SLPKVMSNVHDFFVHVAAKVESIHQYIESM+T+YLAD R RG+ +DPFLEADRRETAKQEAAAKRVHPTLHLPA   ++QP TQV
Sbjct:   97 TNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEGFEFDASRIVQELGGINTAMDRQKAVLHELMIVAKDMLRNAEIAVRSFMMLQPRFPHWKQGGGVVSVGSQPSQGQGTNPAPASSGQQQAVTTTVQVSDFYRGIPKKPTAFLLQTVVRFEKYLNECRQWVEELEQLLALDSDKYS-RHA-SLLESLPKVMSNVHDFFVHVAAKVESIHQYIESMRTSYLADQRRRGECHDPFLEADRRETAKQEAAAKRVHPTLHLPASTTSTQPSTQV 387          
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy Swiss-Prot
Match: PERA_ALOVR (Peroxidase A (Fragments) OS=Aloe vera PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 6.282e-9
Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = -3
Query:  289 KVMSNVHDFFVHVAAKVESIHQYIESMKTAYLA 387
            +VMSNVHDFFVHVAAKVESIHQYIESM+   L+
Sbjct:   79 RVMSNVHDFFVHVAAKVESIHQYIESMRYGSLS 111          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TYX8_GOSRA0.000e+098.26Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061DHM3_THECC0.000e+091.64Hydroxyproline-rich glycoprotein family protein OS... [more]
I1J922_SOYBN1.958e-17185.71Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
A0A0B2RUQ7_GLYSO2.280e-17185.71Peroxidase A OS=Glycine soja GN=glysoja_003306 PE=... [more]
A0A067K6J9_JATCU5.122e-17185.37Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
W9R2Y6_9ROSA2.220e-16985.71Uncharacterized protein OS=Morus notabilis GN=L484... [more]
I1LHI3_SOYBN1.241e-16885.02Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
K7LNA0_SOYBN2.200e-16885.02Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
G7K9F1_MEDTR4.879e-16784.32Hydroxyproline-rich glycoprotein family protein, p... [more]
A0A059B067_EUCGR6.770e-16783.28Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010677 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NUP58_ARATH1.492e-13873.38Nuclear pore complex protein NUP58 OS=Arabidopsis ... [more]
PERA_ALOVR6.282e-981.82Peroxidase A (Fragments) OS=Aloe vera PE=1 SV=1[more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 98..118
NoneNo IPR availablePFAMPF15967Nucleoporin_FG2coord: 182..292
e-value: 3.3E-8
score: 32.4
IPR024882Nucleoporin p58/p45PANTHERPTHR13437NUCLEOPORIN P58/P45 NUCLEOPORIN-LIKE PROTEIN 1coord: 1..132
coord: 172..358

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010677 ID=g.arboreum_cottongen_reftransV1_0010677|Name=g.arboreum_cottongen_reftransV1_0010677|organism=Gossypium arboreum|type=contig|length=1094bp
AAACAGAGAAGATGACATGGAAGAAGCAGGAGTAGAGGACGGTGTACTAA
AAAGAGACAATCCACCTCCCGAGGAAGCTGCTGATGTTGCTGCAGAAGTC
TGTGGGGCAGAGGCTGCAGCAGGAGCTGCTGAGCTGGCAAACAAGCCAGC
AACTTGAGTTGGCGGTTGTGAATTTGCAGGTAAATGCAAGGTTGGATGTA
CCCTCTTAGCAGCAGCTTCTTGTTTGGCAGTTTCTCTCCTATCAGCCTCA
AGAAAAGGATCATTAACATCTCCTCTGTGACGGTGATCAGCAAGATAAGC
TGTTTTCATTGATTCAATATATTGATGAATGCTTTCCACCTTGGCAGCCA
CATGAACAAAAAAGTCATGCACATTGGACATGACTTTTGGAAGAGATTGC
AATAAAGAGGATGCGTGATTGATAGAGTTTCTATCAGAATTCAAAAGGAG
AAGTTGTTCCAACTCTTCAATCCATTGGCGGCACTCACCCAAATACTTCT
CAAATCTAGCAACTGTATACTGTAGAAAGGGAGAAGGCTTCTTTGGAAGC
CCATGGTAAAAATCAAAAACTGGTACCATGGATGCAGCAGTTGGTTGAAC
CCCAGAACCTGGTGTTGTTGTTGCCCCTGGAACCTGGGATGGTGCAGTGG
CATTTGAAGCACCTCCTGTGTTTGAATGAACAAACCGTGGCCGAAGCATC
ATGAAAGAACGAACAGCAACCTCTGTGTTCCTTAACATATCTTTCACAGT
ACTCATCAATTCCTGCAGCAAAGCTTTCTGCCTCTCCATGGCAGTACTGA
TTCCTCCAAGTTCCTGAACAATGTGGCTGGCATCAAGCTCGAAGCCTTCA
TTGGACACCGAAGAATCATAAAGGCGAGTACACTGGTCTAACCTTTGGCT
TTCATCCCTATACTCCAATATCCTTTCCTCAATTTGAAGCAGAAATTTTT
GAGAATCAGGATGGAGATCAGCCCATTTGGTGCTGTAACTAGCAGGAGTC
TTGTCATTAGTAAAAAGAAAAAGGGGTTGTTGCTGCTGCTGTTGTTGTTG
CTGCTGCTGCTGCTGTTGTGGAAACTGCAATTGTGGTTGCTGTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR024882Nucleoporin_p58/p45
Vocabulary: Biological Process
TermDefinition
GO:0006913nucleocytoplasmic transport
Vocabulary: Cellular Component
TermDefinition
GO:0005643nuclear pore