g.arboreum_cottongen_reftransV1_0018831, g.arboreum_cottongen_reftransV1_0018831 (contig) Gossypium arboreum
Overview
Alignments
The following features are aligned
Analyses
This contig is derived from or has results from the following analyses
Homology
BLAST of g.arboreum_cottongen_reftransV1_0018831 vs. ExPASy TrEMBL
Match: A0A0D2PXM7_GOSRA (Uncharacterized protein (Fragment) OS=Gossypium raimondii GN=B456_005G220000 PE=4 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.800e-10 Identity = 36/57 (63.16%), Postives = 41/57 (71.93%), Query Frame = -3 Query: 315 LPLGVKVLIDVAVMDDLQVVEVFQHEAV*LILGVHLLKTQMLMNDLAHGIGIMETLS 485 LPLGVKVL+D AVMD LQV+ VF +A LI G HLL+T MNDLA GIGI L+ Sbjct: 245 LPLGVKVLVDGAVMDGLQVLGVFHRKAALLIHGAHLLETHRSMNDLADGIGIPGDLA 301
BLAST of g.arboreum_cottongen_reftransV1_0018831 vs. ExPASy TrEMBL
Match: A0A0C3MLP8_9PROT (Uncharacterized protein (Fragment) OS=Nitrosospira sp. NpAV GN=SQ11_16100 PE=4 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 3.445e-7 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = -3 Query: 567 VVEVTTGMNVIAIVGKTEIXXXXXXXXXXXLTILKAEEEAAMMMI 701 VVEVTTGMNVIAIVGKTEILGAVAGV VLVLTILKAEEEAAMMMI Sbjct: 18 VVEVTTGMNVIAIVGKTEILGAVAGVVVLVLTILKAEEEAAMMMI 62 The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0018831 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL) Total hits: 2
BLAST of g.arboreum_cottongen_reftransV1_0018831 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt) Total hits: 0
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
Sequences
The
following sequences are available for this feature:
contig sequence >g.arboreum_cottongen_reftransV1_0018831 ID=g.arboreum_cottongen_reftransV1_0018831; Name=g.arboreum_cottongen_reftransV1_0018831; organism=Gossypium arboreum; type=contig; length=703bpback to top |