g.arboreum_cottongen_reftransV1_0000159, g.arboreum_cottongen_reftransV1_0000159 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0000159
Unique Nameg.arboreum_cottongen_reftransV1_0000159
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length427
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr13chromosomeg.arboreum_cottongen_reftransV1_0000159:1..427 .
Chr13:71037015..71037441 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A0D2TSR2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G003600 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 5.866e-92
Identity = 140/142 (98.59%), Postives = 142/142 (100.00%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            FEALRRKLSQMEDAKESHS+IFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYED+AEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL
Sbjct:    3 FEALRRKLSQMEDAKESHSDIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDNAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 144          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A0B0P9I5_GOSAR (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3-like protein OS=Gossypium arboreum GN=F383_01107 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 7.246e-92
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL
Sbjct:  188 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 329          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A0D2S632_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G003600 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.456e-90
Identity = 140/142 (98.59%), Postives = 142/142 (100.00%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            FEALRRKLSQMEDAKESHS+IFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYED+AEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL
Sbjct:  159 FEALRRKLSQMEDAKESHSDIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDNAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 300          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A061FS25_THECC (SU(VAR)3-9, putative OS=Theobroma cacao GN=TCM_044594 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.688e-74
Identity = 119/142 (83.80%), Postives = 131/142 (92.25%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+ALRR+LSQMEDAKESHS I KRA+LKAGNIM +KGVRTN KKRIGVVPGVEIGDIFFFRMEL ++GLHSQSMAGID+M +K D EGE VA+SIVSSGGY+DDAEDPDVLVY+GQGGNA+ DKEASDQKL RGNLALERSL
Sbjct:  163 FDALRRRLSQMEDAKESHSGIIKRADLKAGNIMMSKGVRTNMKKRIGVVPGVEIGDIFFFRMELCVVGLHSQSMAGIDYMVVKGDSEGEPVALSIVSSGGYDDDAEDPDVLVYSGQGGNANKDKEASDQKLERGNLALERSL 304          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A0D2TXJ0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G301500 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 8.180e-72
Identity = 116/143 (81.12%), Postives = 130/143 (90.91%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKA-DIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+ALRRKLSQMEDAKE HS I KR++LKA N+M TKGVRTN KKRIGVVPGVEIGDIFFFRMEL L+GLH  SMAGID+M +K+ D+EGERVA+SIVSSGGY+DDAEDPDVLVY+GQGG+AS DKEASDQ+LVRGNLALERS 
Sbjct:  155 FDALRRKLSQMEDAKELHSSIIKRSDLKAANMMLTKGVRTNMKKRIGVVPGVEIGDIFFFRMELSLVGLHFPSMAGIDYMAIKSGDLEGERVALSIVSSGGYDDDAEDPDVLVYSGQGGSASRDKEASDQQLVRGNLALERSF 297          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A0D2RWC8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G020600 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.248e-67
Identity = 109/142 (76.76%), Postives = 127/142 (89.44%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+ALRRKLSQMEDA E HS I KR++LKAGN+M +KGVRTN KKRIG VPGVEIGDIFFFRMEL L+GLH+QSMAGID+  +K ++EGE VA+SIVSSGGY++DAEDPD+L+Y+GQGGNA  DKEASDQKL RGNLALE+SL
Sbjct:  157 FDALRRKLSQMEDAVELHSGIIKRSDLKAGNMMMSKGVRTNMKKRIGAVPGVEIGDIFFFRMELCLVGLHAQSMAGIDY--IKGELEGELVALSIVSSGGYDNDAEDPDILIYSGQGGNAGRDKEASDQKLERGNLALEKSL 296          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: B9SHW2_RICCO (Histone-lysine N-methyltransferase OS=Ricinus communis GN=RCOM_0622490 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 9.737e-62
Identity = 99/143 (69.23%), Postives = 129/143 (90.21%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASAD-KEASDQKLVRGNLALERSL 427
            F+ALRR+LSQ+ED+KE+ + + KRA+LKAGN++ +KGVR+N +KRIG VPGVEIGDIFFFRME+ +IGLHSQSMAGID+M ++ DI+ + +A+SIVSSGGY+D+AED DVL+Y+GQGGNA+++ KEA+DQKL RGNLALERSL
Sbjct:  172 FDALRRRLSQLEDSKEAPTGLIKRADLKAGNVLMSKGVRSNMRKRIGAVPGVEIGDIFFFRMEMCVIGLHSQSMAGIDYMIVRGDIDEDPLAVSIVSSGGYDDEAEDRDVLIYSGQGGNANSNKKEAADQKLERGNLALERSL 314          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: B9GLS5_POPTR (Histone-lysine N-methyltransferase family protein OS=Populus trichocarpa GN=POPTR_0001s07390g PE=4 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 4.262e-61
Identity = 101/142 (71.13%), Postives = 123/142 (86.62%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+ALRR+LSQ+EDAKES + I +RA+LKAGNI+ TK VRTN +KRIG VPGVEIGDIFFFRME+ L+GLH+ SMAGID+M ++ D+E E +A+SIVSSG Y+DDAED DVL+Y+GQGG A+ DK A+DQKL RGNLALERSL
Sbjct:  160 FDALRRRLSQLEDAKESPAGIIRRADLKAGNILMTKQVRTNTRKRIGTVPGVEIGDIFFFRMEMCLLGLHAPSMAGIDYMSVRNDLEEEPLAVSIVSSGYYDDDAEDKDVLIYSGQGGAANKDKGATDQKLERGNLALERSL 301          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: A0A067EA43_CITSI (Histone-lysine N-methyltransferase OS=Citrus sinensis GN=CISIN_1g006089mg PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 5.960e-61
Identity = 99/143 (69.23%), Postives = 126/143 (88.11%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKE-ASDQKLVRGNLALERSL 427
            F+ALRR++SQ+EDAKE+ + + +RA+LKA NI+ +KGVRTN +KR+GVVPGVEIGDIFFFRME+ LIGLHSQSMAGID+M  ++D++ E VA+SI+SSGGY+DDAED D+L+Y+GQGGNA+   E A+DQKL RGNLALERSL
Sbjct:  154 FDALRRRISQIEDAKETSTGLIRRADLKASNILMSKGVRTNMRKRLGVVPGVEIGDIFFFRMEMCLIGLHSQSMAGIDYMITRSDLDEEPVAVSIISSGGYDDDAEDSDILIYSGQGGNANRKGEQAADQKLERGNLALERSL 296          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Match: V4SXK1_9ROSI (Histone-lysine N-methyltransferase OS=Citrus clementina GN=CICLE_v10000524mg PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 6.881e-61
Identity = 99/143 (69.23%), Postives = 126/143 (88.11%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKE-ASDQKLVRGNLALERSL 427
            F+ALRR++SQ+EDAKE+ + + +RA+LKA NI+ +KGVRTN +KR+GVVPGVEIGDIFFFRME+ LIGLHSQSMAGID+M  ++D++ E VA+SI+SSGGY+DDAED D+L+Y+GQGGNA+   E A+DQKL RGNLALERSL
Sbjct:  154 FDALRRRISQIEDAKETSTGLIRRADLKASNILMSKGVRTNMRKRLGVVPGVEIGDIFFFRMEMCLIGLHSQSMAGIDYMITRSDLDEEPVAVSIISSGGYDDDAEDSDILIYSGQGGNANRKGEQAADQKLERGNLALERSL 296          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH1_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 6.908e-58
Identity = 91/142 (64.08%), Postives = 116/142 (81.69%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+ALRR+ +Q+EDAKE+ S I KR +LK+G+    +GVRTN KKR G+VPGVEIGD+FFFR E+ L+GLHS SMAGID++ +K + E E +A SIVSSG Y++D  +PDVL+YTGQGGNA  DK++SDQKL RGNLALE+SL
Sbjct:  165 FDALRRRFAQLEDAKEAVSGIIKRPDLKSGSTCMGRGVRTNTKKRPGIVPGVEIGDVFFFRFEMCLVGLHSPSMAGIDYLVVKGETEEEPIATSIVSSGYYDNDEGNPDVLIYTGQGGNADKDKQSSDQKLERGNLALEKSL 306          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH3_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 1.876e-46
Identity = 80/142 (56.34%), Postives = 106/142 (74.65%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+A+RR+LSQ+E  K + S        KA   + + GVRTN KKR+G VPG+E+GDIFF R+E+ L+GLH Q+MAGID++  KA  + E +A SIVSSG YE +A+DP+ L+Y+GQGGNA  +++ASDQKL RGNLALE SL
Sbjct:  170 FDAVRRRLSQVEFTKSATS--------KAAGTLMSNGVRTNMKKRVGTVPGIEVGDIFFSRIEMCLVGLHMQTMAGIDYIISKAGSDEESLATSIVSSGRYEGEAQDPESLIYSGQGGNADKNRQASDQKLERGNLALENSL 303          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH1_TOBAC (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.978e-41
Identity = 79/142 (55.63%), Postives = 109/142 (76.76%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+  RR+++Q++++++      +R +LKA N++ TKGVRTN  KRIG  PG+E+GDIFFFRMEL L+GLH+ +MAGID+M +K  ++ E +A+SIVSSGGY+DD  D DVL+YTGQGG    D +  DQKL RGNLALE+S+
Sbjct:  220 FDLFRRRMTQIDESRDGPGS-GRRPDLKASNMLMTKGVRTNQTKRIGNAPGIEVGDIFFFRMELCLVGLHAPTMAGIDYMSVKLTMDEEPLAVSIVSSGGYDDDGGDGDVLIYTGQGGVQRKDGQVFDQKLERGNLALEKSV 360          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH2_ARATH (Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.515e-31
Identity = 62/121 (51.24%), Postives = 82/121 (67.77%), Query Frame = 2
Query:   68 KRANLKAGNIMFTKGVRTNGKKRI-GVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            +R+++ A  IM  +G+  N  K I G V GVE+GDIFF+RMEL ++GLH Q+ AGID +  +    GE +A SIV SGGYEDD +  DVLVYTG GG     K+  +Q+LV GNL +ERS+
Sbjct:  182 RRSDMAAAYIMRDRGLWLNYDKHIVGPVTGVEVGDIFFYRMELCVLGLHGQTQAGIDCLTAERSATGEPIATSIVVSGGYEDDEDTGDVLVYTGHGGQDHQHKQCDNQRLVGGNLGMERSM 302          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH9_ARATH (Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 7.671e-29
Identity = 57/116 (49.14%), Postives = 78/116 (67.24%), Query Frame = 2
Query:   83 KAGNIMFTKGVRTNGKKRI-GVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            KAG++M    +  N  KRI G +PGV++GDIFFFR EL ++GLH    +GIDF+       GE +A S++ SGGYEDD +  DV++YTGQGG     ++A  Q+L  GNLA+ERS+
Sbjct:  185 KAGSMMRDCMLWMNRDKRIVGSIPGVQVGDIFFFRFELCVMGLHGHPQSGIDFLTGSLSSNGEPIATSVIVSGGYEDDDDQGDVIMYTGQGGQDRLGRQAEHQRLEGGNLAMERSM 300          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH5_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.246e-26
Identity = 69/150 (46.00%), Postives = 90/150 (60.00%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLK----AGNIMFTKGVRT-NGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKE---ASDQKLVRGNLALERSL 427
            F    +K+ Q E+A+    +     N K    A  I+ +KG    +G + IG VPGVE+GD F +RMEL L+G+H  S +GID+M    D  GE VA SIVSSGGY D  ++ DVL+YTGQGGN    K      DQ+LV GNLAL+ S+
Sbjct:  317 FHETCKKIMQEEEARPRKRD---GGNFKVVCEASKILKSKGKNLYSGTQIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYM---KDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKKNNEPPKDQQLVTGNLALKNSI 460          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: YDG1_ARATH (YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.270e-26
Identity = 55/121 (45.45%), Postives = 80/121 (66.12%), Query Frame = 2
Query:   71 RANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGY-EDDAEDPDVLVYTGQGGNA-SADKEASDQKLVRGNLALERSL 427
            R +LK   ++   G + N +KRIG VPG+ IGD+F ++ EL ++GLHS+ M GID++ +  D    R+  SIV+S GY  +D  +  V+VYTG+GGN  +  K+  DQKLV+GNLAL  S+
Sbjct:  153 RIDLKTLTVLEKMGKQVNTEKRIGSVPGINIGDVFQYKTELRVVGLHSKPMCGIDYIKLGDD----RITTSIVASEGYGYNDTYNSGVMVYTGEGGNVINKQKKTEDQKLVKGNLALATSM 269          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH6_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 8.052e-24
Identity = 67/153 (43.79%), Postives = 88/153 (57.52%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAK-ESHSEIFK--RANLKAGNIMFTKGVRTN-GKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGN-------ASADKEASDQKLVRGNLALERSL 427
            F  + RK+ Q ++AK E      K  R + +A  I+   G   N G   +G VPGVE+GD F +RMEL ++G+H  S AGID+M         +VA SIV+SGGY+D  ++ DVL YTGQGGN           KE  DQKL+ GNLAL  S+
Sbjct:  280 FHGVCRKILQEDEAKPEDQRRKGKGLRIDFEASTILKRNGKFLNSGVHILGEVPGVEVGDEFQYRMELNILGIHKPSQAGIDYMKYGK----AKVATSIVASGGYDDHLDNSDVLTYTGQGGNVMQVKKKGEELKEPEDQKLITGNLALATSI 428          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH7_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.105e-23
Identity = 59/144 (40.97%), Postives = 89/144 (61.81%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSE-IFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFM-PMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+A+RR+L Q+     +H E I   A   +GN     GV+TN ++RIG VPG+ +GDIF++  E+ L+GLH  +  GIDF    ++ +EG   A+ +V++G Y+ + E  D L+Y+GQGG       A DQ++  GNLALE S+
Sbjct:  189 FDAVRRRLCQI-----NHPEDILTTA---SGNCT-KMGVKTNTRRRIGAVPGIHVGDIFYYWGEMCLVGLHKSNYGGIDFFTAAESAVEGH-AAMCVVTAGQYDGETEGLDTLIYSGQGG-TDVYGNARDQEMKGGNLALEASV 321          
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Match: SUVH8_ARATH (Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.432e-23
Identity = 56/142 (39.44%), Postives = 81/142 (57.04%), Query Frame = 2
Query:    2 FEALRRKLSQMEDAKESHSEIFKRANLKAGNIMFTKGVRTNGKKRIGVVPGVEIGDIFFFRMELILIGLHSQSMAGIDFMPMKADIEGERVAISIVSSGGYEDDAEDPDVLVYTGQGGNASADKEASDQKLVRGNLALERSL 427
            F+A+RR+L Q+   K+          L A       GVRTN  +RIG +PGV++GDIF++  E+ L+GLH  +  GID +  K        A S+V+SG Y+++ ED + L+Y+G GG      +  DQ L RGN ALE S+
Sbjct:  272 FDAVRRRLCQLNYRKDK--------ILTASTNCMNLGVRTNMTRRIGPIPGVQVGDIFYYWCEMCLVGLHRNTAGGIDSLLAKESGVDGPAATSVVTSGKYDNETEDLETLIYSGHGG------KPCDQVLQRGNRALEASV 399          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TSR2_GOSRA5.866e-9298.59Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0P9I5_GOSAR7.246e-92100.00Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
A0A0D2S632_GOSRA2.456e-9098.59Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FS25_THECC3.688e-7483.80SU(VAR)3-9, putative OS=Theobroma cacao GN=TCM_044... [more]
A0A0D2TXJ0_GOSRA8.180e-7281.12Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RWC8_GOSRA1.248e-6776.76Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9SHW2_RICCO9.737e-6269.23Histone-lysine N-methyltransferase OS=Ricinus comm... [more]
B9GLS5_POPTR4.262e-6171.13Histone-lysine N-methyltransferase family protein ... [more]
A0A067EA43_CITSI5.960e-6169.23Histone-lysine N-methyltransferase OS=Citrus sinen... [more]
V4SXK1_9ROSI6.881e-6169.23Histone-lysine N-methyltransferase OS=Citrus cleme... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0000159 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
SUVH1_ARATH6.908e-5864.08Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
SUVH3_ARATH1.876e-4656.34Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
SUVH1_TOBAC2.978e-4155.63Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
SUVH2_ARATH1.515e-3151.24Histone-lysine N-methyltransferase family member S... [more]
SUVH9_ARATH7.671e-2949.14Histone-lysine N-methyltransferase family member S... [more]
SUVH5_ARATH4.246e-2646.00Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
YDG1_ARATH8.270e-2645.45YDG domain-containing protein At5g47150 OS=Arabido... [more]
SUVH6_ARATH8.052e-2443.79Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
SUVH7_ARATH1.105e-2340.97Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]
SUVH8_ARATH1.432e-2339.44Histone-lysine N-methyltransferase, H3 lysine-9 sp... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003105SRA-YDGSMARTSM00466G9a_1coord: 32..132
e-value: 6.8E-26
score: 102.0
IPR003105SRA-YDGPFAMPF02182SAD_SRAcoord: 36..131
e-value: 2.0E-26
score: 92.4
IPR003105SRA-YDGGENE3D2.30.280.10coord: 48..132
e-value: 2.2E-26
score: 91.8
IPR003105SRA-YDGPROSITEPS51015YDGcoord: 37..132
score: 34.655
NoneNo IPR availablePANTHERPTHR22884:SF383HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-9 SPECIFIC SUVH1-RELATEDcoord: 1..132
NoneNo IPR availablePANTHERPTHR22884SET DOMAIN PROTEINScoord: 1..132
IPR015947PUA-like domainSUPERFAMILY88697PUA domain-likecoord: 19..132

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0000159 ID=g.arboreum_cottongen_reftransV1_0000159|Name=g.arboreum_cottongen_reftransV1_0000159|organism=Gossypium arboreum|type=contig|length=427bp
GTTCGAAGCACTTAGGAGAAAGCTTAGCCAAATGGAAGATGCAAAGGAAT
CACATTCTGAGATTTTCAAGCGTGCTAACTTAAAAGCTGGCAACATTATG
TTCACGAAAGGGGTACGGACTAATGGAAAAAAGCGAATTGGAGTTGTTCC
TGGTGTTGAAATCGGTGACATTTTCTTCTTCCGAATGGAGTTGATTTTAA
TCGGGTTGCATTCTCAATCCATGGCTGGAATTGACTTCATGCCTATGAAG
GCTGATATTGAGGGAGAGCGAGTGGCTATAAGCATTGTTTCGTCCGGAGG
GTATGAAGACGATGCTGAAGATCCCGATGTTTTGGTATACACCGGGCAAG
GTGGGAATGCTAGTGCCGATAAAGAAGCATCCGATCAGAAGCTTGTGAGG
GGCAATCTTGCTTTGGAAAGGAGCTTG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR003105SRA_YDG
IPR015947PUA-like_sf
Vocabulary: Molecular Function
TermDefinition
GO:0042393histone binding