g.arboreum_cottongen_reftransV1_0011260, g.arboreum_cottongen_reftransV1_0011260 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0011260
Unique Nameg.arboreum_cottongen_reftransV1_0011260
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length932
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0011260:1..932 .
Chr11:40976514..40980163 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A0D2RGY4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G177400 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 3.814e-111
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGIFTRSTVSRKPNESMRLIVTTFVGVVFGFLIGLSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV
Sbjct:    1 MGIFTRSTVSRKPNESMRLIVTTFVGVVFGFLIGLSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 186          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A0D2PVV1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G161300 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 3.345e-91
Identity = 158/186 (84.95%), Postives = 168/186 (90.32%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGIFTRS VSRKPNESMRLIVT FVGVVFGFLIGL FPKLSLTKF++S+ I T ID KYTEYT   PS ST + HP+ NN SSAN T KKIWVPSNPRGAERLPPGIV+AESDLYLRRLWGKP+EDLTS PKYLVTFTVGY+QRKNIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSK+AIHVSV
Sbjct:    1 MGIFTRSVVSRKPNESMRLIVTAFVGVVFGFLIGLCFPKLSLTKFSLSTSIFTAIDFKYTEYTKLGPSSSTRVSHPVVNNGSSANVTLKKIWVPSNPRGAERLPPGIVRAESDLYLRRLWGKPSEDLTSKPKYLVTFTVGYDQRKNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKKAIHVSV 186          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A0B0PGX3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_04429 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 4.932e-91
Identity = 157/186 (84.41%), Postives = 168/186 (90.32%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGIFTRS VSRKPNESMRLIVTTF GVVFGFLIGL FPKLSLTKF++S+ ILT ID KYTEYT   PS ST + HP+ NN S AN T +KIWVPSNPRGAERLPPGIV+AESDLYLRRLWGKP+EDLTS PKYLVTFTVGY+QRKNIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSK+AIHVSV
Sbjct:    1 MGIFTRSIVSRKPNESMRLIVTTFFGVVFGFLIGLCFPKLSLTKFSLSTSILTAIDFKYTEYTKLGPSSSTHVSHPVGNNGSCANVTLRKIWVPSNPRGAERLPPGIVRAESDLYLRRLWGKPSEDLTSKPKYLVTFTVGYDQRKNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKKAIHVSV 186          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A061EEJ6_THECC (Uncharacterized protein isoform 2 OS=Theobroma cacao GN=TCM_010561 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 4.069e-90
Identity = 159/186 (85.48%), Postives = 168/186 (90.32%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGIFTRS VSRKPNESMRLI+TTFVGVVFGFLIG+SFP LS TK N+SS ILT+ID  YT+Y NS PS ST +  PI NN SSAN TSKKIWVPSNPRGAERL PGIV+AESDLYLRRLWGKP+EDLTSTPKYLVTFTVGYNQR NIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSKQAIHVSV
Sbjct:    1 MGIFTRSKVSRKPNESMRLIITTFVGVVFGFLIGVSFPTLSFTKLNLSSSILTSIDFSYTQYKNSGPSNSTHVPPPIGNNGSSANVTSKKIWVPSNPRGAERLAPGIVRAESDLYLRRLWGKPSEDLTSTPKYLVTFTVGYNQRMNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSV 186          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A061E7T4_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_010561 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 4.260e-90
Identity = 159/186 (85.48%), Postives = 168/186 (90.32%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGIFTRS VSRKPNESMRLI+TTFVGVVFGFLIG+SFP LS TK N+SS ILT+ID  YT+Y NS PS ST +  PI NN SSAN TSKKIWVPSNPRGAERL PGIV+AESDLYLRRLWGKP+EDLTSTPKYLVTFTVGYNQR NIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSKQAIHVSV
Sbjct:    1 MGIFTRSKVSRKPNESMRLIITTFVGVVFGFLIGVSFPTLSFTKLNLSSSILTSIDFSYTQYKNSGPSNSTHVPPPIGNNGSSANVTSKKIWVPSNPRGAERLAPGIVRAESDLYLRRLWGKPSEDLTSTPKYLVTFTVGYNQRMNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSV 186          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A0D2T709_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G161300 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 6.533e-81
Identity = 125/151 (82.78%), Postives = 135/151 (89.40%), Query Frame = 1
Query:  478 SFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
             FPKLSLTKF++S+ I T ID KYTEYT   PS ST + HP+ NN SSAN T KKIWVPSNPRGAERLPPGIV+AESDLYLRRLWGKP+EDLTS PKYLVTFTVGY+QRKNIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSK+AIHVSV
Sbjct:   20 CFPKLSLTKFSLSTSIFTAIDFKYTEYTKLGPSSSTRVSHPVVNNGSSANVTLKKIWVPSNPRGAERLPPGIVRAESDLYLRRLWGKPSEDLTSKPKYLVTFTVGYDQRKNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKKAIHVSV 170          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: V7D1Y5_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_001G255300g PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.345e-67
Identity = 128/190 (67.37%), Postives = 151/190 (79.47%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANATS----KKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGI TRS+ SRKP+E MR  VTTF+G+VFGF IG+S P LS+TK N+ SG+L +ID+ Y E   +     + + +   N RSS+   +     KIWVPSNPRGAERLPPGIV+AESD YLRRLWGKP+EDLTS PKYLVTFTVGY Q+KNIDAAVKKFSGNF++LLFHYDG+TTEWDEFEWSK+AIHVS 
Sbjct:    1 MGIITRSSASRKPSEIMRFFVTTFIGIVFGFFIGVSVPTLSITKLNLPSGLLPSIDLSYIEDRYTGRQAWSFMNN--GNKRSSSQVKALNDTSKIWVPSNPRGAERLPPGIVEAESDFYLRRLWGKPSEDLTSKPKYLVTFTVGYEQKKNIDAAVKKFSGNFSVLLFHYDGRTTEWDEFEWSKRAIHVSA 188          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: I1LNG4_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.404e-67
Identity = 127/190 (66.84%), Postives = 148/190 (77.89%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSANAT----SKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            MGI TRS+  RKP+E MR  VTTF+ +V GF IG+S P LS+TK N+ SG+L +ID+ Y E   +     + + +   N RSS+       + KIWVPSNPRGAERLPPGIV+AESD YLRRLWGKP+EDLTS P YLVTFTVGY+Q+ NIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSKQAIHVSV
Sbjct:    1 MGIITRSSAGRKPSEIMRFFVTTFISIVLGFFIGVSVPTLSITKLNLPSGLLPSIDLSYIEDRYTGRQAWSFMNN--GNKRSSSQVQLSNDTSKIWVPSNPRGAERLPPGIVEAESDYYLRRLWGKPSEDLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSV 188          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: I1MYM9_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 5.537e-66
Identity = 126/190 (66.32%), Postives = 151/190 (79.47%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSA----NATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            M I TRS+  RKP+E M+  +TTF+G+VFGF IG+S P LS+TK N+ SG+L +ID+ Y E   +     + + +   N RSS+    ++ + KIWVPSNPRGAERLPPGIV+AESD YLRRLWGKP+EDLTS P YLVTFTVGY+Q+ NIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSKQAIHVSV
Sbjct:    1 MVIITRSSAGRKPSEIMKFFLTTFIGIVFGFFIGVSIPTLSITKLNLPSGLLPSIDLSYIEDRYAGRQAWSFMNN--GNKRSSSQVQLSSDTSKIWVPSNPRGAERLPPGIVEAESDFYLRRLWGKPSEDLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSV 188          
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Match: A0A0B2SGN1_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_048217 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 5.537e-66
Identity = 126/190 (66.32%), Postives = 151/190 (79.47%), Query Frame = 1
Query:  373 MGIFTRSTVSRKPNESMRXXXXXXXXXXXXXXXXXSFPKLSLTKFNISSGILTTIDIKYTEYTNSVPSGSTPLQHPIDNNRSSA----NATSKKIWVPSNPRGAERLPPGIVKAESDLYLRRLWGKPNEDLTSTPKYLVTFTVGYNQRKNIDAAVKKFSGNFTILLFHYDGQTTEWDEFEWSKQAIHVSV 930
            M I TRS+  RKP+E M+  +TTF+G+VFGF IG+S P LS+TK N+ SG+L +ID+ Y E   +     + + +   N RSS+    ++ + KIWVPSNPRGAERLPPGIV+AESD YLRRLWGKP+EDLTS P YLVTFTVGY+Q+ NIDAAVKKFSGNFTILLFHYDG+TTEWDEFEWSKQAIHVSV
Sbjct:    1 MVIITRSSAGRKPSEIMKFFLTTFIGIVFGFFIGVSIPTLSITKLNLPSGLLPSIDLSYIEDRYAGRQAWSFMNN--GNKRSSSQVQLSSDTSKIWVPSNPRGAERLPPGIVEAESDFYLRRLWGKPSEDLTSRPNYLVTFTVGYDQKNNIDAAVKKFSGNFTILLFHYDGRTTEWDEFEWSKQAIHVSV 188          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2RGY4_GOSRA3.814e-111100.00Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PVV1_GOSRA3.345e-9184.95Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0PGX3_GOSAR4.932e-9184.41Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A061EEJ6_THECC4.069e-9085.48Uncharacterized protein isoform 2 OS=Theobroma cac... [more]
A0A061E7T4_THECC4.260e-9085.48Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
A0A0D2T709_GOSRA6.533e-8182.78Uncharacterized protein OS=Gossypium raimondii GN=... [more]
V7D1Y5_PHAVU1.345e-6767.37Uncharacterized protein OS=Phaseolus vulgaris GN=P... [more]
I1LNG4_SOYBN1.404e-6766.84Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
I1MYM9_SOYBN5.537e-6666.32Uncharacterized protein OS=Glycine max PE=4 SV=1[more]
A0A0B2SGN1_GLYSO5.537e-6666.32Uncharacterized protein OS=Glycine soja GN=glysoja... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0011260 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0011260 ID=g.arboreum_cottongen_reftransV1_0011260|Name=g.arboreum_cottongen_reftransV1_0011260|organism=Gossypium arboreum|type=contig|length=932bp
TTCAGGTCTTTTTTCCTTCACGTTTTCTATATTTTTTTTTCTGTTAGTAA
GGCAATCAAGAAGTTCGTTCTCTCAATTCTCTCAATTCTCGAGAGAGAAG
CATAAACTTATTTCTTGCATATTTTCAGTTAAAGAGGAGAAGGTGATTTT
TCTCGTGATTTAGAGCCATTTTAAATACAGTTTCAGTTTCCATCAGATCC
TTTTCAGTTGTTCTCAATTATCTTTCCATTCAGGTCCTTTTGCTGAGGGT
CTCTCTTTGTTTCATGGAGAATGGGCAACTGAATGCCTGCTAATTAATGC
TCAAAGCCTCTTGCAATCTGAATTGCCCATAGTTTGTTGTGAATATACAA
TTCAGACGAATTTTTAAATAGAATGGGGATCTTTACACGCAGTACGGTTA
GTAGAAAGCCAAATGAGAGCATGAGGCTTATTGTGACAACATTTGTTGGA
GTAGTTTTTGGCTTCTTAATTGGATTATCTTTCCCAAAATTGTCATTAAC
AAAGTTCAATATATCATCTGGCATTCTTACGACCATTGATATCAAATACA
CTGAATATACCAACTCAGTCCCCTCAGGCTCAACTCCTTTGCAGCATCCG
ATTGATAATAATAGAAGCTCTGCTAATGCCACATCAAAGAAGATTTGGGT
CCCATCAAATCCTCGAGGTGCGGAAAGACTACCACCTGGAATTGTTAAAG
CTGAATCAGACTTATACTTACGCAGATTGTGGGGCAAGCCGAATGAGGAC
TTGACCAGCACTCCAAAGTATCTTGTCACATTTACTGTTGGCTATAATCA
ACGAAAGAATATTGATGCTGCAGTTAAAAAGTTTTCAGGGAATTTTACCA
TCCTTCTCTTTCATTACGATGGTCAAACAACTGAATGGGATGAGTTTGAG
TGGTCAAAGCAGGCAATACATGTGAGTGTTCG
back to top