g.arboreum_cottongen_reftransV1_0002948, g.arboreum_cottongen_reftransV1_0002948 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0002948
Unique Nameg.arboreum_cottongen_reftransV1_0002948
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length713
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr7chromosomeg.arboreum_cottongen_reftransV1_0002948:1..713 .
Chr7:87591985..87593540 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A0B0PHR3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_04886 PE=4 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.185e-159
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS
Sbjct:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 238          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A0D2Q4F1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G114800 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 2.050e-155
Identity = 231/239 (96.65%), Postives = 234/239 (97.91%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            AGQTQDQFEVYF+KADLDGDGRISG EAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPS+QNLSMRPQQTMPAATALHPSQGIAAPE SRGGNIVGQPQAMPAGSTPLSHQSMPT ATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS
Sbjct:    2 AGQTQDQFEVYFRKADLDGDGRISGAEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSEQNLSMRPQQTMPAATALHPSQGIAAPESSRGGNIVGQPQAMPAGSTPLSHQSMPTGATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 240          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A0D2R4B4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G114800 PE=4 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 1.147e-154
Identity = 231/239 (96.65%), Postives = 234/239 (97.91%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            AGQTQDQFEVYF+KADLDGDGRISG EAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPS+QNLSMRPQQTMPAATALHPSQGIAAPE SRGGNIVGQPQAMPAGSTPLSHQSMPT ATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS
Sbjct:    2 AGQTQDQFEVYFRKADLDGDGRISGAEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSEQNLSMRPQQTMPAATALHPSQGIAAPESSRGGNIVGQPQAMPAGSTPLSHQSMPTGATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 240          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A0D2M9M2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G114800 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 3.290e-153
Identity = 231/239 (96.65%), Postives = 234/239 (97.91%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            AGQTQDQFEVYF+KADLDGDGRISG EAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPS+QNLSMRPQQTMPAATALHPSQGIAAPE SRGGNIVGQPQAMPAGSTPLSHQSMPT ATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS
Sbjct:    2 AGQTQDQFEVYFRKADLDGDGRISGAEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSEQNLSMRPQQTMPAATALHPSQGIAAPESSRGGNIVGQPQAMPAGSTPLSHQSMPTGATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 240          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A0D2NLI2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G114800 PE=4 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 4.153e-153
Identity = 231/239 (96.65%), Postives = 234/239 (97.91%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            AGQTQDQFEVYF+KADLDGDGRISG EAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPS+QNLSMRPQQTMPAATALHPSQGIAAPE SRGGNIVGQPQAMPAGSTPLSHQSMPT ATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS
Sbjct:    2 AGQTQDQFEVYFRKADLDGDGRISGAEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSEQNLSMRPQQTMPAATALHPSQGIAAPESSRGGNIVGQPQAMPAGSTPLSHQSMPTGATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 240          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A061FF26_THECC (Calcium ion binding protein, putative isoform 1 OS=Theobroma cacao GN=TCM_034414 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.793e-110
Identity = 187/242 (77.27%), Postives = 202/242 (83.47%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPST---APRPQAAVS 712
            AG  QDQFEVYF++ADLDGDGRISG EAV+FFQGSGL K VLAQIW +ADQSHSGFLSKQEF+NALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  Q+GAAV  +SP  GFRGPGVPNA MS Q+FPSQQN SMRP  TMPA TA  P QGIAAPEFSRGG+IVGQ Q M AGST    QSMPT ATGPS TNQN+SS+WL+GR  GASTGP+GV PST   A +PQ   S
Sbjct:    2 AGPNQDQFEVYFRRADLDGDGRISGAEAVAFFQGSGLPKPVLAQIWMHADQSHSGFLSKQEFYNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQIGAAVQTASPIPGFRGPGVPNASMSPQYFPSQQNPSMRP--TMPAGTAPRPPQGIAAPEFSRGGSIVGQTQGMLAGSTARPLQSMPTGATGPSFTNQNISSDWLAGRTVGASTGPQGVTPSTPSAASKPQTVFS 241          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A061FEI1_THECC (Calcium ion binding protein, putative isoform 2 OS=Theobroma cacao GN=TCM_034414 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.018e-110
Identity = 187/242 (77.27%), Postives = 202/242 (83.47%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPST---APRPQAAVS 712
            AG  QDQFEVYF++ADLDGDGRISG EAV+FFQGSGL K VLAQIW +ADQSHSGFLSKQEF+NALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  Q+GAAV  +SP  GFRGPGVPNA MS Q+FPSQQN SMRP  TMPA TA  P QGIAAPEFSRGG+IVGQ Q M AGST    QSMPT ATGPS TNQN+SS+WL+GR  GASTGP+GV PST   A +PQ   S
Sbjct:    2 AGPNQDQFEVYFRRADLDGDGRISGAEAVAFFQGSGLPKPVLAQIWMHADQSHSGFLSKQEFYNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQIGAAVQTASPIPGFRGPGVPNASMSPQYFPSQQNPSMRP--TMPAGTAPRPPQGIAAPEFSRGGSIVGQTQGMLAGSTARPLQSMPTGATGPSFTNQNISSDWLAGRTVGASTGPQGVTPSTPSAASKPQTVFS 241          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A061FLE0_THECC (Calcium ion binding protein, putative isoform 3 OS=Theobroma cacao GN=TCM_034414 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.583e-81
Identity = 149/195 (76.41%), Postives = 161/195 (82.56%), Query Frame = 2
Query:  143 YADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATT--QMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPST---APRPQAAVS 712
            +ADQSHSGFLSKQEF+NALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPAT+  Q+GAAV  +SP  GFRGPGVPNA MS Q+FPSQQN SMRP  TMPA TA  P QGIAAPEFSRGG+IVGQ Q M AGST    QSMPT ATGPS TNQN+SS+WL+GR  GASTGP+GV PST   A +PQ   S
Sbjct:    2 HADQSHSGFLSKQEFYNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATSAPQIGAAVQTASPIPGFRGPGVPNASMSPQYFPSQQNPSMRP--TMPAGTAPRPPQGIAAPEFSRGGSIVGQTQGMLAGSTARPLQSMPTGATGPSFTNQNISSDWLAGRTVGASTGPQGVTPSTPSAASKPQTVFS 194          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: A0A067KWZ7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_08066 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.235e-78
Identity = 147/261 (56.32%), Postives = 174/261 (66.67%), Query Frame = 2
Query:   17 DQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ-RRELTPDIVKAALYGPAAAKIPAPQINFPAT----------------TQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPT------------VATGPSLTNQNMSSNWLSGRPGGASTGPRGVAPSTAPRPQAAVS 712
            DQFE YF++ADLDGDGRISG EAV+FFQGS L KQVLAQIW YADQS  GFL + EF+NAL+LVTVAQ +RELTPDIVKAALYGPAAAKIPAP+IN PAT                 QMG   P +S + GFRGPGVPN GM+Q +FP QQ+ S+RP Q +    + HP QG  +PEFSRGG +VG  QAMP G+ P   Q+MPT             A G S+   N+S++WL G+   A TGP    PS   +P+A VS
Sbjct:    2 DQFEAYFRRADLDGDGRISGAEAVAFFQGSNLPKQVLAQIWTYADQSRIGFLGRAEFYNALRLVTVAQTKRELTPDIVKAALYGPAAAKIPAPKINLPATPVLHVPQVNPVVAASAPQMGTVAPTASQNPGFRGPGVPNPGMNQHYFPPQQSPSIRPPQAIQPGASSHPPQGFISPEFSRGGGMVGNSQAMPTGTAPRPSQAMPTSTAPRPSQLMPSSAPGTSIPTSNISTSWLGGKTSAAMTGPPST-PSATMQPRAQVS 261          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Match: B9R8Q3_RICCO (Calcium ion binding protein, putative OS=Ricinus communis GN=RCOM_1601620 PE=4 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.592e-75
Identity = 136/236 (57.63%), Postives = 166/236 (70.34%), Query Frame = 2
Query:    2 AGQ-TQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ-RRELTPDIVKAALYGPAAAKIPAPQINF-------------PATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTGP 664
            AGQ   DQFE YF++ADLDGDGRISG EAV+FFQG+ L KQVLAQIW +ADQS +GFL + EFFNALKLVTVAQ +RELTPDIVKAALYGPAAAKIP P+IN              P+  QMGA  P    S+GFRGPG+PNAG++QQ+FPS Q+ +MRP Q +P   A  P+QGI  PEFSRG +++G  Q +P G+      SMP     PS+   N+S++WL G+   A +GP
Sbjct:    2 AGQPNMDQFEAYFRRADLDGDGRISGTEAVNFFQGANLPKQVLAQIWMHADQSRTGFLGRPEFFNALKLVTVAQSKRELTPDIVKAALYGPAAAKIPPPKINLLATPVQQVNPMMTPSAPQMGAPPPTPVQSLGFRGPGLPNAGINQQYFPSPQSQTMRPPQAIPPGIASRPTQGITNPEFSRGSSMMGHSQVVPTGTASRPPHSMPVPTASPSIPTSNISTDWLGGKSSLAISGP 237          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EHD2_ARATH (EH domain-containing protein 2 OS=Arabidopsis thaliana GN=EHD2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.875e-16
Identity = 62/219 (28.31%), Postives = 94/219 (42.92%), Query Frame = 2
Query:    8 QTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQR-RELTPDIVKAALYGPAAAKIPAPQINFPATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATGPSLTNQNMSSNWLSGRPGGASTG 661
            + Q  ++ +F  AD DGDGR+SG +A  FF  S LS+Q L Q+WA AD    GFL   EF  A+KLV++AQ   E+T D++K +        I    +  P    +   V                  +S+ +   + N+  +PQ T  A T    S+ I  P+ +    + G  +       PL           P LT+ +  +  +    G  STG
Sbjct:   15 EHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLGLSEFITAMKLVSLAQEGHEITSDLLKGS--------IDMKSVELPVLEGLENVVSKQK--------------VSKTNVDVEDNVVTKPQVT--AKTPWFKSKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFNDFASPVLTSSDFDAKPMVMLLGQYSTG 209          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EHD1_ARATH (EH domain-containing protein 1 OS=Arabidopsis thaliana GN=EHD1 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 5.931e-11
Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 2
Query:    8 QTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            + Q  ++ +F+ +D DGDGRI+G +A+ FF  S L +  L QIWA AD    G+L  +EF  A++LV++AQ
Sbjct:   14 ENQMIYKEWFEFSDSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIADSKRQGYLGFKEFIVAMQLVSLAQ 84          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: YHLA_SCHPO (Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.101e-10
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 2
Query:    2 AGQTQDQFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRR 226
            + + Q  F+  FK AD    G I+G EAV F + SGL+ QVL QIW  AD  + GFL+   F  A++LV +AQ +
Sbjct:    6 SAEEQTAFDQLFKIADKQDIGVITGEEAVPFLEKSGLAPQVLGQIWQIADAENRGFLTFSGFVIAMRLVALAQEK 80          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EPS15_HUMAN (Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 2.367e-10
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   23 FEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            +E Y+++ D    GR+   +A +F + SGL   +L +IW  AD    G L+KQEFF AL+LV  AQ
Sbjct:   19 YEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQ 84          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EPS15_MOUSE (Epidermal growth factor receptor substrate 15 OS=Mus musculus GN=Eps15 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.565e-10
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   23 FEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            +E Y+++ +    GR+  ++A +F + SGL   +L +IW  AD    G LSKQEFF AL+LV  AQ
Sbjct:   19 YEKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLADTDGKGVLSKQEFFVALRLVACAQ 84          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EP15R_HUMAN (Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens GN=EPS15L1 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.003e-9
Identity = 30/66 (45.45%), Postives = 39/66 (59.09%), Query Frame = 2
Query:   23 FEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            +E Y+K+ D    GR+   EA  F + SGLS  +L +IW  AD    GFL KQ F+ AL+LV  AQ
Sbjct:   19 YESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDKQGFYVALRLVACAQ 84          

HSP 2 Score: 61.2326 bits (147), Expect = 1.633e-9
Identity = 34/84 (40.48%), Postives = 48/84 (57.14%), Query Frame = 2
Query:   20 QFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQR--------RELTPDIV 247
            +F+  F K DLD DG +SG E    F  SGL++ +LA IWA AD   +G LSK +F  AL +  + Q+        + L+PD+V
Sbjct:  278 RFDEIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKDQF--ALAMYFIQQKVSKGIDPPQVLSPDMV 359          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EP15R_MOUSE (Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus GN=Eps15l1 PE=1 SV=3)

HSP 1 Score: 61.6178 bits (148), Expect = 1.229e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query:   20 QFEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQR--------RELTPDIV 247
            +F+  F K DLD DG +SG E    F  SGL++ +LA IWA AD   +G LSK++F  AL +  + Q+        + L+PD+V
Sbjct:  276 RFDEIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKEQF--ALAMYFIQQKVSKGIDPPQVLSPDMV 357          

HSP 2 Score: 61.2326 bits (147), Expect = 1.547e-9
Identity = 30/66 (45.45%), Postives = 39/66 (59.09%), Query Frame = 2
Query:   23 FEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            +E Y+K+ D    GR+   EA  F + SGLS  +L +IW  AD    GFL KQ F+ AL+LV  AQ
Sbjct:   19 YESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDKQGFYVALRLVACAQ 84          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: EPS15_DICDI (Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum GN=eps15 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.589e-9
Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   23 FEVYFKKADLDGDGRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQ 220
            +E  F+ AD+D DG I G+   SFF+ S LS  +L  IW  +D  ++G+L+  +FF ALKLV++AQ
Sbjct:   15 YEELFQIADVDKDGVI-GLNDASFFRNSMLSNDILRDIWQLSD-VNNGYLNIDDFFVALKLVSLAQ 78          
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Match: ITSN2_HUMAN (Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3)

HSP 1 Score: 54.299 bits (129), Expect = 3.697e-7
Identity = 51/177 (28.81%), Postives = 78/177 (44.07%), Query Frame = 2
Query:   62 GRISGVEAVSFFQGSGLSKQVLAQIWAYADQSHSGFLSKQEFFNALKLVTVAQRRELTPDIVKAALYGPAAAKIPAPQINFPATTQMGAAVPPSSPSVGFRGPGVPNAGMSQQHFPSQQNLSMRPQQTMPAATALHPSQGIAAPEFSRGGNIVGQPQAMPAGSTPLSHQSMPTVATG 592
            G I+G +A +FF  SGL   VLA+IWA +D +  G + +QEF  A+KL+ +  + +  P ++   +  P     P     F   +    ++P   P      P  P   +S     S  NL   P   MP  T L PS  ++      G   + QP  +P  S+ L H S  ++  G
Sbjct:   38 GYITGDQARNFFLQSGLPAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFS-PLISARFGMGSMPNLSIPQPLP------PAAPITSLSSA--TSGTNL---PPLMMP--TPLVPS--VSTSSLPNGTASLIQPLPIPYSSSTLPHGSSYSLMMG 198          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PHR3_GOSAR1.185e-159100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2Q4F1_GOSRA2.050e-15596.65Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2R4B4_GOSRA1.147e-15496.65Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2M9M2_GOSRA3.290e-15396.65Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2NLI2_GOSRA4.153e-15396.65Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FF26_THECC2.793e-11077.27Calcium ion binding protein, putative isoform 1 OS... [more]
A0A061FEI1_THECC3.018e-11077.27Calcium ion binding protein, putative isoform 2 OS... [more]
A0A061FLE0_THECC1.583e-8176.41Calcium ion binding protein, putative isoform 3 OS... [more]
A0A067KWZ7_JATCU1.235e-7856.32Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9R8Q3_RICCO1.592e-7557.63Calcium ion binding protein, putative OS=Ricinus c... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0002948 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
EHD2_ARATH3.875e-1628.31EH domain-containing protein 2 OS=Arabidopsis thal... [more]
EHD1_ARATH5.931e-1143.66EH domain-containing protein 1 OS=Arabidopsis thal... [more]
YHLA_SCHPO1.101e-1044.00Uncharacterized calcium-binding protein C800.10c O... [more]
EPS15_HUMAN2.367e-1042.42Epidermal growth factor receptor substrate 15 OS=H... [more]
EPS15_MOUSE3.565e-1042.42Epidermal growth factor receptor substrate 15 OS=M... [more]
EP15R_HUMAN1.003e-945.45Epidermal growth factor receptor substrate 15-like... [more]
EP15R_MOUSE1.229e-940.48Epidermal growth factor receptor substrate 15-like... [more]
EPS15_DICDI7.589e-945.45Epidermal growth factor receptor substrate 15 homo... [more]
ITSN2_HUMAN3.697e-728.81Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3[more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011992EF-hand domain pairGENE3D1.10.238.10coord: 2..54
e-value: 1.0E-15
score: 56.7
IPR011992EF-hand domain pairSUPERFAMILY47473EF-handcoord: 2..43
NoneNo IPR availablePANTHERPTHR11216:SF72CALCIUM-BINDING EF HAND-CONTAINING PROTEINcoord: 4..161
NoneNo IPR availablePANTHERPTHR11216EH DOMAINcoord: 4..161
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 14..26
IPR000261EH domainPROSITEPS50031EHcoord: 1..57
score: 10.429
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1..36
score: 10.134

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0002948 ID=g.arboreum_cottongen_reftransV1_0002948|Name=g.arboreum_cottongen_reftransV1_0002948|organism=Gossypium arboreum|type=contig|length=713bp
GGCGGGGCAAACTCAGGATCAATTCGAAGTTTACTTCAAGAAAGCAGATT
TAGATGGGGATGGCAGAATTAGTGGAGTTGAGGCTGTTTCTTTCTTTCAA
GGATCCGGTTTGTCCAAACAAGTCCTCGCTCAGATATGGGCATATGCTGA
CCAAAGTCATAGTGGTTTCCTGAGCAAGCAAGAGTTTTTTAATGCTCTCA
AGCTTGTGACCGTAGCACAAAGGCGTGAATTAACACCAGACATTGTCAAG
GCAGCATTATATGGCCCTGCTGCAGCAAAAATTCCAGCTCCGCAAATTAA
TTTTCCTGCCACAACACAGATGGGTGCAGCTGTGCCACCATCCTCTCCAA
GTGTTGGGTTCAGAGGACCAGGAGTTCCAAATGCTGGTATGAGCCAGCAA
CATTTTCCATCTCAACAGAACCTCTCAATGAGACCCCAACAAACAATGCC
TGCTGCTACTGCCCTGCACCCTTCTCAAGGTATTGCAGCTCCAGAGTTTT
CTAGGGGAGGTAATATAGTTGGTCAACCTCAAGCTATGCCTGCTGGTTCT
ACTCCACTTTCACATCAATCCATGCCCACCGTTGCTACTGGTCCCAGTTT
AACAAATCAAAATATGTCTAGCAATTGGCTTTCTGGAAGGCCTGGTGGAG
CTTCAACTGGGCCACGAGGGGTCGCTCCATCAACAGCACCAAGGCCACAA
GCTGCAGTTTCAA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
IPR000261EH_dom
IPR002048EF_hand_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding