g.arboreum_cottongen_reftransV1_0020740, g.arboreum_cottongen_reftransV1_0020740 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0020740
Unique Nameg.arboreum_cottongen_reftransV1_0020740
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length3157
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr7chromosomeg.arboreum_cottongen_reftransV1_0020740:1..3156 .
Chr7:78672998..78682093 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A0B0MN31_GOSAR (DNA ligase OS=Gossypium arboreum GN=F383_09558 PE=3 SV=1)

HSP 1 Score: 1488.78 bits (3853), Expect = 0.000e+0
Identity = 779/790 (98.61%), Postives = 779/790 (98.61%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 2514
            MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKSPDSSPTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSS           RDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT
Sbjct:    1 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKSPDSSPTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSS-----------RDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 779          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A0D2RMQ3_GOSRA (DNA ligase OS=Gossypium raimondii GN=B456_003G146000 PE=3 SV=1)

HSP 1 Score: 1469.14 bits (3802), Expect = 0.000e+0
Identity = 769/790 (97.34%), Postives = 774/790 (97.97%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 2514
            MLTFR SHL R T CITRPLTPLLPP SSH LPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKS DSSPT+NPNP KTVGS EVKHDPEVSSDGIGKPINDSPKP+LDEAKK PDSKKVKVGS SERN EMKGKI LLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTF+LIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQIL TRARKNVVVSEIKVDVCIFAFDILYL+GQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQ FLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFET+EVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT
Sbjct:    1 MLTFRQSHLFRCTFCITRPLTPLLPPSSSHFLPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKSLDSSPTENPNPLKTVGSAEVKHDPEVSSDGIGKPINDSPKPNLDEAKKPPDSKKVKVGSASERNVEMKGKIRLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFRLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILITRARKNVVVSEIKVDVCIFAFDILYLNGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQTFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFETTEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 790          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A0D2P1H2_GOSRA (DNA ligase OS=Gossypium raimondii GN=B456_003G146000 PE=3 SV=1)

HSP 1 Score: 1463.36 bits (3787), Expect = 0.000e+0
Identity = 769/795 (96.73%), Postives = 774/795 (97.36%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQ-----IHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 2514
            MLTFR SHL R T CITRPLTPLLPP SSH LPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKS DSSPT+NPNP KTVGS EVKHDPEVSSDGIGKPINDSPKP+LDEAKK PDSKKVKVGS SERN EMKGKI LLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTF+LIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQ     IHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQIL TRARKNVVVSEIKVDVCIFAFDILYL+GQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQ FLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFET+EVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT
Sbjct:    1 MLTFRQSHLFRCTFCITRPLTPLLPPSSSHFLPSNSPFFRPKPLSLSSLNPHSNMSTRPSAFDALMSNARRLAGKKSSSSSSPTKKRKSLDSSPTENPNPLKTVGSAEVKHDPEVSSDGIGKPINDSPKPNLDEAKKPPDSKKVKVGSASERNVEMKGKIRLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFRLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQVMEFEIHYMENGSVEIYSRNAECNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILITRARKNVVVSEIKVDVCIFAFDILYLNGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQTFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFETTEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 795          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A061GXA4_THECC (DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 SV=1)

HSP 1 Score: 1342.79 bits (3474), Expect = 0.000e+0
Identity = 705/791 (89.13%), Postives = 739/791 (93.43%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXX--XTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQ 2511
            MLTFRP HLLR+TC ++RPL    PP SSH LPS   FFRP PL LSSLNP+SNMS+RPSAFDALMSNARRLA KK+SSSSSPTKKRKS DSS   TQ+PN  KT  STEVK D E   +GI KPI DSPKP++DE +K PDSKK+KV S SERNAE+KGKIG LKKKPADFDP MVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVI TTPDDLVA VYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTV+KVFDTF+LIAKESGKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAV+NEQHSKPPPN+QSPLEEAAKIVKQVFSILPVYDK+VPALLTGG+W+L K+C FT G+PVGPMLAKPTKGVAEI+NKFQDIDFICEYKYDGERAQIHYMENG VEIYSRNAE NTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVS+IKVDVCIFAFDILYL+GQPLL EQLKVRKERLYDSFEEE GF+QFATALTSN+LEEIQ FL+SAVS SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYD+ NEEFQSICKIGTGF+E+ELEERSASLR+KVIPEPKSYYR  EMMKPDVWFE +EVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDK PEQASSSEQVAEMYNAQKHNQ
Sbjct:    1 MLTFRPCHLLRHTC-LSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSSLNPYSNMSSRPSAFDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDINGIEKPIEDSPKPNVDETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVVKVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVHNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSFTLGIPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVDVCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSAVSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRTKVIPEPKSYYRYGEMMKPDVWFEATEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKAPEQASSSEQVAEMYNAQKHNQ 790          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A061GYX2_THECC (DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 SV=1)

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 694/782 (88.75%), Postives = 727/782 (92.97%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXX--XTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFE-TSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVA 2481
            MLTFRP HLLR+TC ++RPL    PP SSH LPS   FFRP PL LSSLNP+SNMS+RPSAFDALMSNARRLA KK+SSSSSPTKKRKS DSS   TQ+PN  KT  STEVK D E   +GI KPI DSPKP++DE +K PDSKK+KV S SERNAE+KGKIG LKKKPADFDP MVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVI TTPDDLVA VYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTV+KVFDTF+LIAKESGKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAV+NEQHSKPPPN+QSPLEEAAKIVKQVFSILPVYDK+VPALLTGG+W+L K+C FT G+PVGPMLAKPTKGVAEI+NKFQDIDFICEYKYDGERAQIHYMENG VEIYSRNAE NTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVS+IKVDVCIFAFDILYL+GQPLL EQLKVRKERLYDSFEEE GF+QFATALTSN+LEEIQ FL+SAVS SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYD+ NEEFQSICKIGTGF+E+ELEERSASLR+KVIPEPKSYYR  EMMKPDVWFE T EVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDK PEQASSSEQ  
Sbjct:    1 MLTFRPCHLLRHTC-LSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSSLNPYSNMSSRPSAFDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDINGIEKPIEDSPKPNVDETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVVKVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVHNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSFTLGIPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVDVCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSAVSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRTKVIPEPKSYYRYGEMMKPDVWFEATEEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKAPEQASSSEQAG 781          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A061GYF1_THECC (DNA ligase (Fragment) OS=Theobroma cacao GN=TCM_042160 PE=3 SV=1)

HSP 1 Score: 1215.68 bits (3144), Expect = 0.000e+0
Identity = 650/761 (85.41%), Postives = 684/761 (89.88%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXX--XTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPR 2421
            MLTFRP HLLR+TC ++RPL    PP SSH LPS   FFRP PL LSSLNP+SNMS+RPSAFDALMSNARRLA KK+SSSSSPTKKRKS DSS   TQ+PN  KT  STEVK D E   +GI KPI DSPKP++DE +K PDSKK+KV S SERNAE+KGKIG LKKKPADFDP MVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVI TTPDDLVA VYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTV+KVFDTF+LIAKESGKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAV+NEQHSKPPPN+QSPLEEAAKIVKQVFSILPVYDK+VPALLTGG+W+L K+C FT G+PVGPMLAKPTKGVAEI+NKFQDIDFICEYKYDGERAQIHYMENG VEIYSRNAE NTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVS+IKVDVCIFAFDILYL+GQPLL EQLKVRKERLYDSFEEE GF+QFATALTSN+LEEIQ FL+SAVS SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYD+ NEEFQSICKIGTGF+E+ELEERSASLR+KVIPEPKSYYR  EMMKPDVWFE +E                          GISLRFPR
Sbjct:    1 MLTFRPCHLLRHTC-LSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSSLNPYSNMSSRPSAFDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDINGIEKPIEDSPKPNVDETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVVKVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVHNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSFTLGIPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVDVCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSAVSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRTKVIPEPKSYYRYGEMMKPDVWFEATE--------------------------GISLRFPR 734          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A061H0B6_THECC (DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 SV=1)

HSP 1 Score: 1214.52 bits (3141), Expect = 0.000e+0
Identity = 643/728 (88.32%), Postives = 677/728 (92.99%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXX--XTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEV 2322
            MLTFRP HLLR+TC ++RPL    PP SSH LPS   FFRP PL LSSLNP+SNMS+RPSAFDALMSNARRLA KK+SSSSSPTKKRKS DSS   TQ+PN  KT  STEVK D E   +GI KPI DSPKP++DE +K PDSKK+KV S SERNAE+KGKIG LKKKPADFDP MVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVI TTPDDLVA VYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTV+KVFDTF+LIAKESGKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAV+NEQHSKPPPN+QSPLEEAAKIVKQVFSILPVYDK+VPALLTGG+W+L K+C FT G+PVGPMLAKPTKGVAEI+NKFQDIDFICEYKYDGERAQIHYMENG VEIYSRNAE NTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVS+IKVDVCIFAFDILYL+GQPLL EQLKVRKERLYDSFEEE GF+QFATALTSN+LEEIQ FL+SAVS SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYD+ NEEFQSICKIGTGF+E+ELEERSASLR+KVIPEPKSYYR  EMMKPDVWFE +EV
Sbjct:    1 MLTFRPCHLLRHTC-LSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSSLNPYSNMSSRPSAFDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDINGIEKPIEDSPKPNVDETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVVKVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVHNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSFTLGIPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVDVCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSAVSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDDRNEEFQSICKIGTGFTESELEERSASLRTKVIPEPKSYYRYGEMMKPDVWFEATEV 727          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: A0A061GYB3_THECC (DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 SV=1)

HSP 1 Score: 1160.59 bits (3001), Expect = 0.000e+0
Identity = 605/683 (88.58%), Postives = 635/683 (92.97%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXX--XTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKI 2187
            MLTFRP HLLR+TC ++RPL    PP SSH LPS   FFRP PL LSSLNP+SNMS+RPSAFDALMSNARRLA KK+SSSSSPTKKRKS DSS   TQ+PN  KT  STEVK D E   +GI KPI DSPKP++DE +K PDSKK+KV S SERNAE+KGKIG LKKKPADFDP MVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNM RTVI TTPDDLVA VYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTV+KVFDTF+LIAKESGKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAV+NEQHSKPPPN+QSPLEEAAKIVKQVFSILPVYDK+VPALLTGG+W+L K+C FT G+PVGPMLAKPTKGVAEI+NKFQDIDFICEYKYDGERAQIHYMENG VEIYSRNAE NTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVS+IKVDVCIFAFDILYL+GQPLL EQLKVRKERLYDSFEEE GF+QFATALTSN+LEEIQ FL+SAVS SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYD+ NEEFQSICKI
Sbjct:    1 MLTFRPCHLLRHTC-LSRPLNLRFPPSSSHFLPSKPSFFRPPPLFLSSLNPYSNMSSRPSAFDALMSNARRLAAKKNSSSSSPTKKRKSLDSSPSKTQSPNSTKTQDSTEVKPDQESDINGIEKPIEDSPKPNVDETQKPPDSKKMKVVSVSERNAELKGKIGSLKKKPADFDPKMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIDTTPDDLVAAVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVVKVFDTFRLIAKESGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVHNEQHSKPPPNIQSPLEEAAKIVKQVFSILPVYDKVVPALLTGGIWNLSKTCSFTLGIPVGPMLAKPTKGVAEIVNKFQDIDFICEYKYDGERAQIHYMENGIVEIYSRNAERNTGKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSDIKVDVCIFAFDILYLNGQPLLQEQLKVRKERLYDSFEEEAGFYQFATALTSNELEEIQAFLDSAVSLSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDDRNEEFQSICKI 682          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: V4SB42_9ROSI (DNA ligase OS=Citrus clementina GN=CICLE_v10027871mg PE=3 SV=1)

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 567/742 (76.42%), Postives = 641/742 (86.39%), Query Frame = 1
Query:  310 STRPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPIN---DSPKPDLDEAKKTPD---SKKVKVGSTS--ERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQ 2511
            S+ P+AF  LMS A +       +SSS +   K   +  TQNP    +V   +++   E  S+ + KPI+   D+P     E++ TP     +KV V S S  E+ AE+K  I LLKKK  +FDP MVACWEKGERVPF+FLSL FD+ISNETGRIVITDIVCNM RTV+ TTP+DLV  VYLAANK+APAHEGLELGIGDASIIKALAEACGRTES VK QY++ GDLGLVA+ASRSSQSMMRKPDPLT+ KVFDTF+LIAKE+GKDSQEKKKNRIK+LLVAATDCEPQYLIRLLQ+KLRIG +EQTLLAALGQA VYNEQHSKPPPN+QSPLEEAAKIVKQVFS+LPVY+KIVPALLT GVW+L  +C FTPG+P+GPMLAKPTKGV+EI+NKFQD++F CEYKYDGERAQIHY+E+GSVEIYSRNAE NTGKFPDVV A+SR KK SV+SFVLDCE+VAYDR ++KILPFQ LSTRARKNV +S+IKVDVCI+AFDILY +GQPLL EQL+VR+E LYDSFEEEPGFFQFAT LTSNDL+EIQ FL++AV +SCEGLIIKT+DRDATYEPSKRSLNWLKLKKDY+ESIGD+LDLVPIAAFHGRGKRTG YGAFLLACYD NNEEFQSICKIGTGFSEA LEERS+SLRSKVIP+P+ YYR ++ + PDVWFE +EVWEVKAADLTISPVHRAAIG+VDPDKGISLRFPRL+RVREDKTPEQASSSEQVAEMY AQK N 
Sbjct:    3 SSAPNAFQVLMSAAAKKKPSPQPNSSSSSSSPKKRRTLDTQNPKTTNSVVGDKIQEVAEEPSNDLVKPISNQIDNPTDSEKESQPTPSPPKKRKVNVNSVSAKEKVAELKSNIVLLKKKAGEFDPKMVACWEKGERVPFIFLSLVFDMISNETGRIVITDIVCNMLRTVMETTPEDLVPVVYLAANKIAPAHEGLELGIGDASIIKALAEACGRTESHVKKQYQEMGDLGLVAKASRSSQSMMRKPDPLTITKVFDTFRLIAKEAGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQSKLRIGLAEQTLLAALGQATVYNEQHSKPPPNIQSPLEEAAKIVKQVFSVLPVYEKIVPALLTDGVWNLSNTCSFTPGIPIGPMLAKPTKGVSEIVNKFQDMEFTCEYKYDGERAQIHYLEDGSVEIYSRNAERNTGKFPDVVLAVSRLKKPSVRSFVLDCEIVAYDREKQKILPFQTLSTRARKNVSLSDIKVDVCIYAFDILYRNGQPLLQEQLRVRREHLYDSFEEEPGFFQFATTLTSNDLDEIQKFLDAAVDASCEGLIIKTMDRDATYEPSKRSLNWLKLKKDYIESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDSNNEEFQSICKIGTGFSEAMLEERSSSLRSKVIPKPRPYYRFADTLSPDVWFEPTEVWEVKAADLTISPVHRAAIGVVDPDKGISLRFPRLIRVREDKTPEQASSSEQVAEMYTAQKLNH 744          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Match: M5W3M2_PRUPE (DNA ligase OS=Prunus persica GN=PRUPE_ppa001632mg PE=3 SV=1)

HSP 1 Score: 1078.54 bits (2788), Expect = 0.000e+0
Identity = 569/784 (72.58%), Postives = 645/784 (82.27%), Query Frame = 1
Query:  214 LPPFSSHILPSNSPFFRPKPXXXXX-------XNPH-SNMSTRPSAFDALMSNARRLAGXXXXXXXXXXXXXXX--------XXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKKV-KVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 2514
            L P S H L ++   FR KP SLS         NP+   MS+RPSAFDALMS AR  A KK   +S   K++                +N +P +   S EVK   E SS+G                +  P +KKV       ER AE+K +I LLKKK  DFDP ++A W +GERVPF F+ LAFDLI+NETGRIVITDIVCN+ RTV+ TTP+DLV  VYLAAN++APAHEGLELGIGDASIIKALAEACGRTE+ VK QYK+ GDLGLVA+ASRSSQSMMRKPD LTV KVF TF+ +AKESGKDSQEKKKN IK+LLVAATDCEPQYLIRLLQTKLRIG +EQTLLAALGQAAV+ E+HS PP ++QSP+EEAAKIVKQV+S+LP YDKI+PALL+GGVW+LPK+C FT GVPVGPMLAKPTKGV+EI+ KFQD ++ CEYKYDGERAQIHYM++GSVEIYSRNAE NTGKFPDVV A+SR KKSSV SFVLDCELVAYDRV++KILPFQ+LSTRARKNV +S+IKVDVCIFAFD+LYL+GQPL+ EQLKVR+E LYDSF EE GFFQFATA+TSND+EEIQ FL++AV SS EGLIIKTL++DATYEPSKRSLNWLKLKKDYMESIGD+LDLVPIAAFHGRGKRTG YGAFLLACYD NNEEFQSICKIGTGFSEA LEERSASLR+KVIP+PKSYYR +E M PDVWF+ SEVWEVKAADLTISPVHRAA+GIVDP+KGISLRFPRLVRVREDK PEQASSS QVAEMY+AQ + ++
Sbjct:   12 LRPHSVHHLSTSISLFRSKPSSLSLTLISLSPKNPNLRAMSSRPSAFDALMSGARAAAAKKKPQASPSKKRKTLEPNPIENPQLLLKPENGSPTQAPESKEVKEALESSSNG---------------GQVVPLAKKVCAAAGAQERMAELKSRIALLKKKAGDFDPKLMANWGEGERVPFAFVCLAFDLIANETGRIVITDIVCNLLRTVMHTTPEDLVPVVYLAANRIAPAHEGLELGIGDASIIKALAEACGRTEAHVKKQYKELGDLGLVAKASRSSQSMMRKPDSLTVTKVFSTFRQLAKESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGQAAVHAEKHSTPPSHIQSPIEEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPKTCSFTLGVPVGPMLAKPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMDDGSVEIYSRNAERNTGKFPDVVVAVSRLKKSSVTSFVLDCELVAYDRVKQKILPFQVLSTRARKNVAMSDIKVDVCIFAFDMLYLNGQPLIQEQLKVRRESLYDSFVEEAGFFQFATAITSNDIEEIQKFLDAAVDSSSEGLIIKTLNKDATYEPSKRSLNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDSNNEEFQSICKIGTGFSEAMLEERSASLRTKVIPKPKSYYRYAETMNPDVWFDASEVWEVKAADLTISPVHRAAVGIVDPNKGISLRFPRLVRVREDKPPEQASSSAQVAEMYSAQANTRS 780          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_ARATH (DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 SV=2)

HSP 1 Score: 1056.59 bits (2731), Expect = 0.000e+0
Identity = 543/792 (68.56%), Postives = 646/792 (81.57%), Query Frame = 1
Query:  145 MLTFRPSHLLRYTCCITRPLTPL-LPPFSSHILPSNSPFFRPKPXXXXXXNPHSNMST-RPSAFDALMSNARRLAGXXXXXXXXXXXXXXXXXXXXTQNPNPPKTVGSTEVKHDPEVSSDGIGKPINDSPKPDLDEAKKTPDSKK-VKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQ 2511
            ML  R S+ LR   CI    T   +  FSS ++      F  +   L   + H  MS+ RPSAFDALMSNAR  A KK+  +++ ++         TQ+ N    +G T V       ++ + +P++DS  P  D +    DSK   K   T  +  EMK KIGLLKKKP DFDP  ++CWEKGERVPFLF++LAFDLISNE+GRIVITDI+CNM RTVIATTP+DLVATVYL+AN++APAHEG+ELGIG+++IIKA++EA GRTE  VK Q  + GDLGLVA+ SRS+Q+MM KP+PLTV+KVFDTF+ IAKESGKDS EKKKNR+K+LLVA TDCEP YL RLLQ KLR+GFS QT+LAALGQAAVYNE+HSKPPPN +SPLEEAAKIVKQVF++LPVYD IVPALL+GGVW+LPK+C FT GVP+GPMLAKPTKGVAEI+NKFQDI F CEYKYDGERAQIH+ME+G+ EIYSRNAE NTGK+PDV  A+SR KK SVKSF+LDCE+VA+DR +KKILPFQILSTRARKNV V++IKV VCIFAFD+LYL+GQ L+ E LK+R+E+LY+SFEE+PG+FQFATA+TSND++EIQ FL+++V   CEGLIIKTLD DATYEP+KRS NWLKLKKDYM+SIGD++DLVPIAAFHGRGKRTG YGAFLLACYD + EEFQSICKIGTGFS+A L+ERS+SLRS+VI  PK YYR  + + PDVWFE +EVWEVKAADLTISPVHRAA GIVDPDKGISLRFPRL+RVREDK PE+A+SSEQ+A++Y AQKHN 
Sbjct:    1 MLAIRSSNYLR---CIPSLCTKTQISQFSSVLIS-----FSRQISHLRLSSCHRAMSSSRPSAFDALMSNARAAAKKKTPQTTNLSRSPNKRKIGETQDAN----LGKTIVSEGTLPKTEDLLEPVSDSANPRSDTSSIAEDSKTGAKKAKTLSKTDEMKSKIGLLKKKPNDFDPEKMSCWEKGERVPFLFVALAFDLISNESGRIVITDILCNMLRTVIATTPEDLVATVYLSANEIAPAHEGVELGIGESTIIKAISEAFGRTEDHVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFRQIAKESGKDSNEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVYNEEHSKPPPNTKSPLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPMLAKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDVALALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLYLNGQQLIQENLKIRREKLYESFEEDPGYFQFATAVTSNDIDEIQKFLDASVDVGCEGLIIKTLDSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVYGAFLLACYDVDKEEFQSICKIGTGFSDAMLDERSSSLRSQVIATPKQYYRVGDSLNPDVWFEPTEVWEVKAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIADLYQAQKHNH 780          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_XENLA (DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 319/633 (50.39%), Postives = 439/633 (69.35%), Query Frame = 1
Query:  652 FDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNV------------QSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQT 2514
            + P   ACW  G++VP+L ++  F+ I  E+ R+   + + N  R+VIA TP+DL+  +YL  N++ PA+EGLELGIG+  ++KA+A+A GR   ++K++ ++KGDLGLVA++SRS+Q  M  P  L    VF   + IA+ +G  S  KK + IK L VA    E +Y+ R L  KLRIG +EQ++L+++ QA          PP V            +S +EE A I+KQ F  LP YD I+P LL  G+ DLPK C  TPG+P+ PMLA PTKG+ E++ +F +  F CEYKYDGERAQIH +ENG V +YSRN E NT K+PD+++ I + KK SVKS +LD E VA D  +K+I PFQ+L+TR RK+V  SEIKV VC++AFD+LYL+G+ L+ E    R++ L DSF E  G F FAT +  ++ +EI  FL+ ++  SCEGL++KTL++DATYE +KRS NWLKLKKDY+E +GDTLDLV I A+ G+GKRTG YG FLLA YDE +EE+Q+ICKIGTGF++ +LE+    L+  VI  P+SYYR     +PD WF+  +VWEVK ADL+ISPVH+AA+G+V+  KGISLRFPR +R+R+DK PE++++S QVA++Y  Q+  Q 
Sbjct:  426 YHPIDDACWCNGQKVPYLAVARTFERIEEESARLKNVETLSNFLRSVIALTPEDLLPCIYLCLNRLGPAYEGLELGIGETILMKAVAQATGRQLEKIKAEAQEKGDLGLVAESSRSNQRTMFTPPKLMASGVFGKLKDIARMTGNASMNKKIDIIKGLFVACRHSEARYIARSLGGKLRIGLAEQSVLSSIAQAVCLTPPGRDAPPTVMDAGKGMSADARKSWIEEKAMILKQTFCELPNYDAIIPILLEHGIDDLPKHCRLTPGIPLKPMLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHVYSRNQENNTTKYPDIISRIPKIKKESVKSCILDTEAVAGDAEKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDMLYLNGESLVKEPFAKRRQLLRDSFLETEGQFMFATYMDKSNTDEISEFLDQSIKDSCEGLMVKTLEQDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRTGIYGGFLLASYDEESEEYQTICKIGTGFTDDDLEKHYNFLKDHVIENPRSYYRWDSATEPDHWFDPVQVWEVKCADLSISPVHKAALGLVEDQKGISLRFPRFLRIRDDKKPEESTNSFQVADLYRKQQQIQN 1058          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_DICDI (DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 PE=3 SV=1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 320/666 (48.05%), Postives = 462/666 (69.37%), Query Frame = 1
Query:  550 KKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAA------------VYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALL-TGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHN 2508
            KK P SKK     T + + ++ GK          + P   A W+KGE VP++ L+  F+++ + + R++I + + N+FR+++  +P DLV T+YL+ NK+ P+++  ELGIG+  +IK+LAE+ GR+   +K +  + GDLG++AQ SRS+Q++M KP PLT+  VF TFQ IA  SG   Q+KKK+ IK LLV+  DCE  Y+IR LQ KLRIG +E+++L AL ++             +++ +        +   +     V + +S LP YD  VP L+   G+ ++  +C    G+PV PMLA+PT G+++++++F D++F CE+KYDGERAQIH + +G+  IY+RN E  T K+PD+VA +++F   +VKSF+LDCE VA+D   KKIL FQ+LSTRARK+V +S+IKV VC+FAFD+LYL+GQ L+ E L  R+E L ++F    G F FA     +D+ +IQ +L  AV  +CEGL++KTL   + YEPS+RS NWLK+KKDYM+ + D+LDLVPI A++G+GKRTG YGA+LLACYDENNEEFQ++CKIGTGFS+ +L   ++ L+  +I +P++ +R S+ +KPDVWF  S VWEV AADL+ISPVH AA GI+DP+KGI+LRFPR +R+R DK+PE A+SS+QV +MY  QK N
Sbjct:  524 KKVPISKKKGNAKTIQADLKVIGK----------YRPIEDAQWKKGEAVPYMVLAKTFEMMESTSSRLIIIEHLANLFRSIMLLSPKDLVMTIYLSINKIGPSYQSKELGIGEHVLIKSLAESTGRSVDVIKQELTEVGDLGIIAQNSRSTQTLMGKPTPLTIQSVFKTFQQIADLSGTGGQQKKKDLIKKLLVSCKDCETLYIIRSLQGKLRIGLAERSVLMALAKSVLVTPPIDGSGQQIFDIRKQMKQEEFEERYQNVVSKVTRAYSQLPNYDLFVPHLIAVNGIDNILSTCSLKVGIPVKPMLAQPTTGISQMLDRFSDMEFTCEFKYDGERAQIHRLPDGTTHIYTRNLEDYTQKYPDIVANVTKFVGPNVKSFILDCEAVAFDAATKKILSFQVLSTRARKSVQLSQIKVPVCVFAFDLLYLNGQSLIDEPLIKRREHLVENFIASDGVFAFAKYSNISDVNDIQSYLEEAVEGNCEGLMVKTLKEKSIYEPSRRSYNWLKIKKDYMQGMTDSLDLVPIGAWYGKGKRTGTYGAYLLACYDENNEEFQTLCKIGTGFSDEQLTTFTSQLKPHLINQPRNQFRFSDSIKPDVWFSPSCVWEVLAADLSISPVHTAASGILDPNKGIALRFPRFIRIRPDKSPEDATSSDQVVDMYQNQKIN 1179          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_HUMAN (DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 311/633 (49.13%), Postives = 439/633 (69.35%), Query Frame = 1
Query:  649 DFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNV------------QSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQ 2511
            ++ P   ACW+ G++VP+L ++  F+ I   + R+ + + + N+ R+V+A +P DL+  +YL+ N + P  +GLELG+GD  ++KA+A+A GR    V+++  +KGD+GLVA+ SRS+Q +M  P PLT   VF  F+ IA+ +G  S  KK + IK L VA    E +++ R L  +LR+G +EQ++LAAL QA        + PP +            ++ LEE   I+KQ F  +P  D+I+P LL  G+  LP+ C  +PG+P+ PMLA PT+G++E++ +F++  F CEYKYDG+RAQIH +E G V+I+SRN E NTGK+PD+++ I + K  SV SF+LD E VA+DR +K+I PFQ+L+TR RK V  SEI+V VC++AFD++YL+G+ L+ E L  R++ L ++F E  G F FAT+L + D+E+I  FL  +V  SCEGL++KTLD DATYE +KRS NWLKLKKDY++ +GDTLDLV I A+ GRGKR G YG FLLA YDE++EE Q+ICK+GTGFS+ ELEE   SL++ V+P P+ Y R    + PD W + S VWEVK ADL++SP++ AA G+VD DKGISLRFPR +RVREDK PEQA++S QVA +Y  Q   Q
Sbjct:  272 NYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQ 904          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_MOUSE (DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 317/656 (48.32%), Postives = 445/656 (67.84%), Query Frame = 1
Query:  586 STSERNAEMKGKIGLLKKKPA--DFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSP------------------LEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYN 2493
            S + R  E KG +      P+  ++ P   ACW+ G++VPFL ++  F+ I   + R+ + + + N+ R+V+A +P DL+  +YL+ N++ P  +GLELG+GD  ++KA+A+A GR    ++++  +KGD+GLVA+ SRS+Q +M  P PLT+  VF  F  IA+ +G  S  KK + IK L VA    E +Y+ R L  +LR+G +EQ++LAAL QA       S  PP  + P                  LEE   I+KQ F  +P  D+I+P LL  G+  LP+ C  +PGVP+ PMLA PT+GV+E++ +F+++DF CEYKYDG+RAQIH +E G V+I+SRN E NTGK+PD+++ I + K  SV SF+LD E VA+DR +K+I PFQ+L+TR RK V  SEI+V VC++AFD++YL+G+ L+ + L  R++ L ++F E  G F F T+L + D E+I  FL  +V  SCEGL++KTLD DATYE +KRS NWLKLKKDY++ +GDTLDLV I A+ GRGKR G YG FLLA YDE +EE Q+ICK+GTGFS+ ELEE   SL++ V+P P+ Y R    + PD W + S VWEVK ADL++SP++ AA G+VD +KGISLRFPR +RVR+DK PEQA++S QVA +Y 
Sbjct:  247 SGTLRKEETKGTLDPANYNPSKNNYHPIEDACWKHGQKVPFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTISGVFTKFCDIARLTGSASMAKKMDIIKGLFVACRHSEARYIARSLSGRLRLGLAEQSVLAALAQAV------SLTPPGQEFPTVVVDAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGVPLKPMLAHPTRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVRQPLSRRRQLLRENFVETEGEFVFTTSLDTKDTEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRIDGAVAPDHWLDPSIVWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVRKDKQPEQATTSNQVASLYR 896          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_RAT (DNA ligase 1 OS=Rattus norvegicus GN=Lig1 PE=2 SV=1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 314/656 (47.87%), Postives = 443/656 (67.53%), Query Frame = 1
Query:  586 STSERNAEMKGKIGLLKKKPA--DFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSP------------------LEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYN 2493
            S + R  E KG        P+  ++ P   ACW+ G++VPFL ++  F+ I   + R+ + + + N+ R+V+A +P DL+  +YL+ N++ P  +GLELG+GD  ++KA+A+A GR    ++++  +KGD+GLVA+ SRS+Q +M    PLTV  VF  F  IA+ +G  S  KK + IK L VA    E +++ R L  +LR+G +EQ++LAAL QA       S  PP  + P                  LEE   I+KQ F  +P  D+I+P LL  G+  LP+ C  +PGVP+ PMLA PT+GV E++ +F+++DF CEYKY G+RAQIH +E G V+I+SRN E N+GK+PD+++ I + K  SV SF+LD E VA+DR +K+I PFQ+L+TR RK V  SEI+V VC++AFD++YL+G+ L  + L  R++ L ++F E  G F FAT+L + D+E+I  FL  +V  SCEGL++KTLD DATYE +KRS NWLKLKKDY+E +GDTLDLV I A+ GRGKR G YG FLLA YDE +EE  +ICK+GTGFS+ ELEE   ++++ ++P P+ Y R    + P+ W + S VWEVK ADLT+SP++RAA G+VD +KGISLRFPR +RVREDK PEQA++S+QVA +Y 
Sbjct:  249 SDTPRKEETKGAPDPTNYNPSKSNYHPIEDACWKHGQKVPFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPTDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPSPPLTVSGVFTKFCDIARLTGSASMAKKMDIIKGLFVACRYSEARFIARSLSGRLRLGLAEQSVLAALAQAG------SLTPPGQEFPTVVVDAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLESLPEHCKLSPGVPLKPMLAHPTRGVREVLKRFEEVDFTCEYKYYGQRAQIHVLEGGEVKIFSRNQEDNSGKYPDIISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLARQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRPGRYGGFLLAAYDEESEELAAICKLGTGFSDEELEEHHQNMQALLLPTPRPYVRIDGAVAPNHWLDPSIVWEVKCADLTLSPIYRAARGMVDKEKGISLRFPRFIRVREDKQPEQATTSDQVASLYR 898          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_DROME (DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 319/725 (44.00%), Postives = 457/725 (63.03%), Query Frame = 1
Query:  427 TQNPNPPKTV----GSTEVKHDPEVSSDGIG------------------KPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNE-----QHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQ---KHNQ 2511
            T +P+PPK V      TE+  +P + S+                      P+ +  K   +   KT D K   +G  S   A  K  +         + P   A W+  +  P+L L+  F +I    GR+ + D + N F +V+  +P+DLV +VYL+ N++APA+EGLELG+ + +++KA+ +A GR  + +KSQ +  GDLG+VA+ SR SQ MM +P PL V  VF   + IAK SG    + K + + ++ VA    E ++ IR L  KLRIG +EQ+LL AL    V        + SK P   +  + +   ++K  +   P YD I+PA+L   + +L + C   PG+P+ PMLA+PTKGV E+  +F  +   CE+KYDGERAQIH  E G + I+SRN+E NT K+PD++A  +   K  VKS+++D E+VA+D  +K+ILPFQ+LSTR RKNV + EIKV VC++ FD+LY++G  L+ + L  R++ L + F+E  G ++FATAL +ND++E+Q FL  ++  +CEGL++KTLD +ATYE +KRS NWLKLKKDY+ ++GD+LDLV I  + G+G+RTG YG FLLACYD  NEE+QSICKIGTGF++ +L+  S  L   V    KSYYR    ++PD WFE  +VWEVK ADL++SP+HRAAIGIVD ++GISLRFPR +R+R+DK  E A+ + QVA MY +Q   K+NQ
Sbjct:   16 TDSPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDSEEKTSPVKNVKKEPKEVDDKTTDKKVTTIGLNS--TAATKEDVENYDPSADSYHPLKNAYWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAKLSG----QSKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQ 734          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_SCHPO (DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 293/597 (49.08%), Postives = 400/597 (67.00%), Query Frame = 1
Query:  718 AFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDR-DATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEM--MKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQ 2499
            AF  I N + R+ I DI+   F  ++   P DL+A VYL+ NK+ P + GLELGIG++ I+KA+ E+ G+T  Q+K  +   GDLGLVAQ SR +Q  M KP  LT+  +FD+ + IA+ SG  SQ +K   IK LL +    EP+YLIR L+ KLR+  +E+T+L AL  A              Q    E  +I++ V+  LP YD IVP L+  G+  L ++C  TPG+P  PMLAKPTK ++E++N F    F CEYKYDGERAQ+H+ E+G   ++SRN+E  + ++PD+  ++S++KK   +SF+LDCE V +DR + KILPFQ L+TR RK+V + +IKV  C+FAFDILYL+GQPLL   L  R++ LY  F+   G F FA       +E I+ FL  +V  SCEGL++K L+  D+ YEPSKRS +WLK+KKDY+  +GD+LDL+ I A++G+GKRT  YGAFLL CYD + E  QSICK+GTGFSE  LE     L+  VI + K +Y  S++   +PDVWFE   +WEV AADL++SPV++AAIG V  DKGISLRFPR +R+REDK+ E A++SEQV+E Y +Q
Sbjct:  155 AFTKIENTSKRLEIIDIMGTYFFGILRDHPSDLLACVYLSINKLGPDYSGLELGIGESIIMKAIGESTGQTLQQIKLSFHKVGDLGLVAQTSRQNQPTMFKPAALTIPFLFDSLKKIAQMSGNQSQNRKIGVIKRLLSSCEGAEPKYLIRALEGKLRLQLAEKTILVALANATAQYHADKNGEKLSQQDRIEGEQILRDVYCQLPSYDLIVPHLIEHGLGTLRETCKLTPGIPTKPMLAKPTKQISEVLNTFDQAAFTCEYKYDGERAQVHFTEDGKFYVFSRNSENMSVRYPDISVSVSKWKKPDARSFILDCEAVGWDRDENKILPFQKLATRKRKDVKIGDIKVRACLFAFDILYLNGQPLLETPLNERRKLLYSMFQPSTGDFTFAKHSDQKSIESIEEFLEESVKDSCEGLMVKMLEGPDSHYEPSKRSRHWLKVKKDYLSGVGDSLDLIVIGAYYGKGKRTSVYGAFLLGCYDPDTETVQSICKLGTGFSEEHLETFYNQLKDIVISKKKDFYAHSDVPAHQPDVWFEPKYLWEVLAADLSLSPVYKAAIGYVQEDKGISLRFPRFIRIREDKSWEDATTSEQVSEFYRSQ 751          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_CAEEL (DNA ligase 1 OS=Caenorhabditis elegans GN=lig-1 PE=3 SV=2)

HSP 1 Score: 548.895 bits (1413), Expect = 5.305e-179
Identity = 286/611 (46.81%), Postives = 405/611 (66.28%), Query Frame = 1
Query:  676 WEKGERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNE-QHSKPPPNVQSPLEEA-AKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQK 2502
            W KG +VP+   +L  + I   +G+  + D +   F  V+  +PDDL A VY++ N++ P++EGLELG+ + S+IKA+A+A GRTE ++K   + KGDLG VAQ SRS+Q M+  P  LTV  VF+    IAK SG  +  KK + I +LL+A    E ++L+R+L  K+RIG  EQ++L+ALG A   ++    K   +    L++A  K VK  +   P Y++++   LT GV  L + C  +PG+P+ PMLA PTKG+ EI+ +F++    CE+KYDGER QIH  E+G + IYSRN E NT K+PD++  IS      V SF++D E+VA D     ILPFQ+LSTR RKN    +  V V +F FD+LY +G+PL+ + L+ R+E L  +F++  G F FAT++ +ND +EI  F + AV + CEGL+IKTLD +ATYE S+RS +WLK+KKDY++ +GDTLDLV + A+ G GKRTG YG +LL CY+   EE++S+CKIGTGF++ +L E+   L+ K I +  SYY+    +KPD  F    V+EVK AD+TISP H+AA G+ D  KGISLRFPR +R+R+DK  + A+SSEQV EMY  Q+
Sbjct:   13 WAKGSKVPYKEFALTLEKIEELSGKKKV-DELAQFFTKVLDFSPDDLTACVYMSVNQLGPSYEGLELGVAENSLIKAVAKATGRTEGKIKEDLRAKGDLGTVAQQSRSNQKMLAVPKALTVPTVFNKLTEIAKLSGTSAMNKKVDAISALLIACQGIEARFLVRMLAGKMRIGLGEQSVLSALGHAFTLSKITDQKVRGDKLDSLKDANVKRVKTAYCECPNYNRLIEVALTEGVEALVEKCKLSPGIPLKPMLAHPTKGIDEIMRRFRNQTMTCEWKYDGERGQIHKREDGQIFIYSRNQENNTTKYPDIIEKISSCIGDGVTSFIVDAEVVAIDEAGL-ILPFQVLSTRKRKNAT-DDNGVKVVVFLFDLLYFNGEPLVRKPLRKRRELLRTNFKKIDGSFYFATSVDTNDTDEINSFFDEAVQNKCEGLMIKTLDTEATYEISRRSHSWLKMKKDYVDGVGDTLDLVVMGAYSGVGKRTGVYGGYLLGCYNPTTEEYESVCKIGTGFTDEDLAEQYKILQDKKIDKSPSYYQFDHTLKPDDTFSPYLVFEVKCADITISPRHKAASGLTDDGKGISLRFPRFLRIRDDKNSDDATSSEQVLEMYKNQE 620          
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Match: DNLI1_YEAST (DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2)

HSP 1 Score: 528.865 bits (1361), Expect = 1.438e-171
Identity = 267/611 (43.70%), Postives = 404/611 (66.12%), Query Frame = 1
Query:  694 VPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHEGLELGIGDASI-IKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQAAVYNEQHSKPPPNVQSP---LEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKFPDVVAAISRXXXXXXXXXXLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDVCIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAVSSSCEGLIIKTLDR-DATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAFLLACYDENNEEFQSICKIGTGFXXXXXXXXXXXXXXKVIPEPKSYYRCSEMMKPDVWFETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYNAQKHNQ 2511
            +P+  +   F+ I   + R+ I  I  + F  ++  +  +L+ T YL  N++ P +E         ++ +K ++E CG++ SQ+K +YKD GDLG +A  +R+ Q  M KP PLTV +VF   + IAK  GKDSQ KK   IK +L A    E ++LIR L++KLRIG +E+T+L +L +A + ++++ +  P+   P   LE A + ++  F  +P Y+ ++ + L  G+ +L K C   PG+P+ PMLAKPTK + E++++FQ   F  EYKYDGERAQ+H + +G++ IYSRN E  T ++P++          + K+ +LDCE VA+D+ Q KILPFQ+LSTR RK+V ++++KV VC+FAFDIL  + + L+++ LK R+E L    +  PG FQ+AT +T+N+L+E+Q FL+ +V+ SCEGL++K L+  ++ YEPSKRS NWLKLKKDY+E +GD+LDL  + A++GRGKRTG YG FLL CY+++  EF++ CKIGTGFS+  L+     L   +I  PK+ +      +PDVWFE + ++EV  ADL++SP+++A  G    DKG+SLRFPR +R+REDK  E A+SS+Q+ E+Y  Q H Q
Sbjct:  146 IPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKA--GSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQ 754          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0MN31_GOSAR0.000e+098.61DNA ligase OS=Gossypium arboreum GN=F383_09558 PE=... [more]
A0A0D2RMQ3_GOSRA0.000e+097.34DNA ligase OS=Gossypium raimondii GN=B456_003G1460... [more]
A0A0D2P1H2_GOSRA0.000e+096.73DNA ligase OS=Gossypium raimondii GN=B456_003G1460... [more]
A0A061GXA4_THECC0.000e+089.13DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 S... [more]
A0A061GYX2_THECC0.000e+088.75DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 S... [more]
A0A061GYF1_THECC0.000e+085.41DNA ligase (Fragment) OS=Theobroma cacao GN=TCM_04... [more]
A0A061H0B6_THECC0.000e+088.32DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 S... [more]
A0A061GYB3_THECC0.000e+088.58DNA ligase OS=Theobroma cacao GN=TCM_042160 PE=3 S... [more]
V4SB42_9ROSI0.000e+076.42DNA ligase OS=Citrus clementina GN=CICLE_v10027871... [more]
M5W3M2_PRUPE0.000e+072.58DNA ligase OS=Prunus persica GN=PRUPE_ppa001632mg ... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0020740 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
DNLI1_ARATH0.000e+068.56DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 ... [more]
DNLI1_XENLA0.000e+050.39DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1[more]
DNLI1_DICDI0.000e+048.05DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 P... [more]
DNLI1_HUMAN0.000e+049.13DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1[more]
DNLI1_MOUSE0.000e+048.32DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2[more]
DNLI1_RAT0.000e+047.87DNA ligase 1 OS=Rattus norvegicus GN=Lig1 PE=2 SV=... [more]
DNLI1_DROME0.000e+044.00DNA ligase 1 OS=Drosophila melanogaster GN=DNA-lig... [more]
DNLI1_SCHPO0.000e+049.08DNA ligase 1 OS=Schizosaccharomyces pombe (strain ... [more]
DNLI1_CAEEL5.305e-17946.81DNA ligase 1 OS=Caenorhabditis elegans GN=lig-1 PE... [more]
DNLI1_YEAST1.438e-17143.70DNA ligase 1 OS=Saccharomyces cerevisiae (strain A... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012308DNA ligase, ATP-dependent, N-terminalGENE3D1.10.3260.10coord: 166..429
e-value: 3.3E-95
score: 318.1
IPR012308DNA ligase, ATP-dependent, N-terminalPFAMPF04675DNA_ligase_A_Ncoord: 185..360
e-value: 2.1E-39
score: 135.5
IPR012308DNA ligase, ATP-dependent, N-terminalSUPERFAMILY117018ATP-dependent DNA ligase DNA-binding domaincoord: 168..417
IPR000977DNA ligase, ATP-dependentTIGRFAMTIGR00574TIGR00574coord: 243..782
e-value: 3.9E-153
score: 508.9
IPR012310DNA ligase, ATP-dependent, centralPFAMPF01068DNA_ligase_A_Mcoord: 427..631
e-value: 1.7E-62
score: 210.5
IPR012310DNA ligase, ATP-dependent, centralPROSITEPS50160DNA_LIGASE_A3coord: 533..669
score: 42.615
IPR012309DNA ligase, ATP-dependent, C-terminalPFAMPF04679DNA_ligase_A_Ccoord: 656..767
e-value: 2.1E-24
score: 85.8
NoneNo IPR availableGENE3D3.30.470.30coord: 457..580
e-value: 2.1E-39
score: 133.6
NoneNo IPR availableGENE3D3.30.1490.70coord: 430..456
e-value: 1.5E-29
score: 101.0
coord: 583..638
e-value: 1.5E-29
score: 101.0
NoneNo IPR availablePANTHERPTHR10459DNA LIGASEcoord: 176..795
NoneNo IPR availablePANTHERPTHR10459:SF10DNA LIGASE 1coord: 176..795
NoneNo IPR availableSUPERFAMILY56091DNA ligase/mRNA capping enzyme, catalytic domaincoord: 419..637
IPR012340Nucleic acid-binding, OB-foldGENE3D2.40.50.140coord: 640..785
e-value: 6.8E-58
score: 194.6
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILY50249Nucleic acid-binding proteinscoord: 639..785
IPR016059DNA ligase, ATP-dependent, conserved sitePROSITEPS00697DNA_LIGASE_A1coord: 451..459
IPR016059DNA ligase, ATP-dependent, conserved sitePROSITEPS00333DNA_LIGASE_A2coord: 605..631

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0020740 ID=g.arboreum_cottongen_reftransV1_0020740|Name=g.arboreum_cottongen_reftransV1_0020740|organism=Gossypium arboreum|type=contig|length=3157bp
ATGGAGGGGGAATTCCATTTCCATATAAAAAGTTTGATCACACTTCCCGC
CATTTCTCTAAATCATCTTTCAAAGCTTTCCCAGCACTTTTCTCTATCCG
ATTCTATTGTGCGTGTGTGTTTTGTTTCATTTCATTCCAATTGAATGCTA
ACGTTTCGCCCATCCCATCTTCTCCGCTATACTTGTTGTATTACTCGTCC
TCTCACCCCTCTCCTTCCTCCCTTTTCCTCCCATATCCTTCCTTCCAACT
CGCCTTTCTTTCGCCCCAAACCCCTCTCTCTTTCTTCCTTAAACCCTCAC
TCCAACATGTCCACTCGCCCCTCCGCCTTCGATGCTTTAATGTCTAATGC
TCGCCGTTTAGCCGGTAAGAAGAGCTCTTCCTCTTCTTCGCCCACCAAGA
AACGCAAATCCCCCGATTCGTCGCCCACCCAAAACCCTAATCCCCCCAAA
ACCGTCGGCTCCACTGAAGTCAAGCACGACCCAGAGGTTTCTAGTGATGG
AATCGGAAAGCCCATTAACGATTCCCCAAAACCCGATTTAGATGAGGCGA
AGAAAACCCCGGATTCGAAGAAGGTGAAGGTGGGGAGCACCTCCGAGAGA
AACGCGGAGATGAAAGGGAAAATTGGTTTGTTGAAGAAGAAGCCGGCGGA
TTTTGATCCCAATATGGTGGCGTGTTGGGAGAAAGGAGAGAGGGTGCCGT
TTTTGTTTCTGAGCCTGGCGTTTGATTTGATATCCAATGAGACGGGTCGG
ATTGTGATAACGGATATTGTTTGCAATATGTTTAGGACTGTTATTGCTAC
CACGCCGGATGATTTGGTGGCGACGGTTTACTTGGCAGCAAATAAGGTTG
CTCCGGCGCACGAGGGGTTAGAGCTGGGAATCGGTGATGCATCCATTATC
AAGGCCCTAGCTGAGGCCTGTGGGAGGACTGAATCACAGGTTAAGAGTCA
GTACAAGGATAAAGGGGACCTGGGCCTTGTTGCACAGGCTAGCCGTTCAT
CTCAATCAATGATGCGCAAGCCTGATCCATTGACTGTTATCAAAGTGTTT
GACACGTTTCAGCTAATTGCTAAGGAATCTGGAAAGGATAGTCAGGAGAA
GAAAAAGAATCGTATCAAATCACTTCTTGTTGCTGCAACTGACTGTGAAC
CTCAGTATTTGATTCGTCTGCTTCAGACAAAGCTGCGGATTGGATTTTCA
GAGCAGACTCTGTTAGCTGCATTAGGACAGGCTGCTGTATATAATGAACA
ACATTCTAAACCACCTCCAAATGTTCAGTCTCCTTTAGAGGAGGCTGCTA
AGATTGTCAAACAAGTTTTTTCTATCCTTCCAGTCTATGATAAAATAGTC
CCAGCACTCTTGACTGGTGGTGTATGGGATCTGCCTAAGAGTTGTGGCTT
TACGCCGGGTGTTCCCGTTGGACCTATGCTAGCAAAACCAACCAAAGGTG
TTGCTGAAATCATAAATAAATTCCAGGACATTGACTTCATATGTGAATAT
AAATATGATGGAGAGCGTGCGCAGATACACTATATGGAGAATGGTTCAGT
TGAGATATACAGCCGAAATGCTGAGTGTAACACTGGAAAGTTTCCTGATG
TTGTTGCTGCAATTTCTAGATTTAAGAAGTCCTCTGTAAAATCATTTGTT
TTGGATTGTGAGCTTGTTGCTTATGATCGTGTTCAAAAGAAAATATTACC
CTTTCAGATCCTTAGTACAAGAGCACGGAAAAATGTGGTAGTGAGTGAAA
TAAAAGTTGATGTGTGCATATTCGCTTTTGACATCTTATACCTTGACGGG
CAACCACTTCTTCATGAGCAACTGAAAGTTCGTAAGGAGAGGCTTTATGA
TTCATTTGAGGAAGAACCTGGGTTTTTTCAATTTGCAACAGCCTTAACAT
CAAATGATCTTGAGGAGATTCAAATATTCCTTAATTCTGCTGTTTCTTCA
AGTTGTGAGGGTTTAATTATCAAAACATTGGATAGAGATGCTACATATGA
GCCATCGAAGCGGTCACTCAACTGGCTAAAATTGAAGAAAGACTACATGG
AAAGTATTGGCGACACATTAGATCTAGTACCTATTGCTGCTTTCCATGGC
CGTGGGAAACGAACTGGCTTCTATGGTGCTTTTCTCTTGGCATGTTATGA
TGAAAATAATGAAGAATTCCAGAGTATCTGTAAAATAGGTACTGGATTTT
CTGAAGCAGAGCTTGAGGAACGTTCTGCCAGTCTCCGCTCTAAAGTGATT
CCTGAACCAAAGTCATACTATCGTTGTTCTGAGATGATGAAGCCGGATGT
ATGGTTTGAGACTTCAGAGGTTTGGGAGGTAAAAGCTGCTGACTTGACCA
TTAGCCCTGTTCATCGTGCTGCTATTGGGATTGTGGATCCTGATAAGGGC
ATATCTCTCCGATTTCCACGTTTAGTTCGTGTTCGAGAAGATAAGACACC
AGAGCAAGCTTCATCATCTGAGCAGGTTGCTGAGATGTATAATGCTCAAA
AACACAATCAAACCAATAACGAAGATGATGGTGAGGATGATTGAGGAATT
CTGACAAGCGTCTCAACATTTTTCCTCCCCGAGTAGACCATAATTTCTAC
AAGTGGCGGGACCTAGAAGCCAAGTATCTCTAGTCATATCAGGGTGCCAC
TCATTGGAGGTGGGTTTGAGTCTTCAGTCAAGTAAACCATGCTAGCTTCT
TCATTTCCTAGCCACTGCTGTATGGACTGGACAATTCCATCAGGTTCTTT
TTCGATTTTCTGCCTAATTTTTTCAAGCAAAGTCTTGCATGAACTGCACT
TGGATGCTGCAATCTTTGTTTTTCAGTTAGAAATTTCCTTGAAATTTGAA
AAATCCATGGCTGCTCCTGTTTTTTTTACTGCTTGAATGCTACGATATTT
CCAGTTTCCTTGCGCCTAATCATGGCATAGCTTGGAAGAGCAAAGTTAGC
CCACAATTCGTTATCCATGTTTATACTTAAACCAGTTGGGGATGTCTCAG
AAAAATTTAGGATAAGTAAGAAAATGAAAATGTCATTATCTAGATGCTCT
CTACTTGCACAATGGGCTTGACCTATGTTTGAGGCCTTGCCGAATTTTGA
TGTAACGGGTAAAAGGGGGAGTAGGGTCATGGGAGTATGGATTTTGATAT
TTGCAGG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR012308DNA_ligase_ATP-dep_N
IPR000977DNA_ligase_ATP-dep
IPR012310DNA_ligase_ATP-dep_cent
IPR012309DNA_ligase_ATP-dep_C
IPR012340NA-bd_OB-fold
IPR016059DNA_ligase_ATP-dep_CS
Vocabulary: Molecular Function
TermDefinition
GO:0003910DNA ligase (ATP) activity
GO:0003677DNA binding
GO:0005524ATP binding
GO:0003909DNA ligase activity
Vocabulary: Biological Process
TermDefinition
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0071897DNA biosynthetic process
GO:0051103DNA ligation involved in DNA repair