g.arboreum_cottongen_reftransV1_0021360, g.arboreum_cottongen_reftransV1_0021360 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0021360
Unique Nameg.arboreum_cottongen_reftransV1_0021360
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2780
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr13chromosomeg.arboreum_cottongen_reftransV1_0021360:1..2780 .
Chr13:39648039..39652260 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A0B0NFH0_GOSAR (Methyl-CpG-binding domain-containing protein 8 OS=Gossypium arboreum GN=F383_15700 PE=4 SV=1)

HSP 1 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 715/715 (100.00%), Postives = 715/715 (100.00%), Query Frame = -3
Query:  634 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM 2778
            VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM
Sbjct:  525 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM 1239          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A0B0NKI0_GOSAR (Methyl-CpG-binding domain-containing protein 8 OS=Gossypium arboreum GN=F383_15700 PE=4 SV=1)

HSP 1 Score: 1438.71 bits (3723), Expect = 0.000e+0
Identity = 707/707 (100.00%), Postives = 707/707 (100.00%), Query Frame = -3
Query:  658 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRAR 2778
            VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRAR
Sbjct:  525 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRAR 1231          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A0D2Q638_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G140700 PE=4 SV=1)

HSP 1 Score: 1408.28 bits (3644), Expect = 0.000e+0
Identity = 690/715 (96.50%), Postives = 703/715 (98.32%), Query Frame = -3
Query:  634 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM 2778
            VETFTDKYNHEG+LLS DEQDKVNM+EKVLADRNCDTK KFCFVTDNKGDITDATAAADLNVCLGSE+ILFTSDKEGISR SDK+DVGFAVNS+EEKKREMA NTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRID VQGNY+EGCSLI SGNKQRVNLVDHLKGASVT DSTHERGSGCGLS SKGDQTCVI+NSLILVSGTLDDPESIMVNESANI+PTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVS+LDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGP+SYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFF+KEEPKHKGGSSIVGNAYARVG FALTGTVQESCSPHFSGNREKIS KNNVPGISSG VLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGY+NHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSI+GFEGLQSGSIEHMEYNFLTAQPSSCSGN KGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM
Sbjct:  568 VETFTDKYNHEGSLLSHDEQDKVNMSEKVLADRNCDTKSKFCFVTDNKGDITDATAAADLNVCLGSENILFTSDKEGISRSSDKIDVGFAVNSVEEKKREMASNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDTVQGNYNEGCSLIPSGNKQRVNLVDHLKGASVTTDSTHERGSGCGLSLSKGDQTCVINNSLILVSGTLDDPESIMVNESANIDPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSELDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPASYKKTHTCTPEYKQDKGSESILYQQYGNQQNSNYETSMNKVSFFTKEEPKHKGGSSIVGNAYARVGAFALTGTVQESCSPHFSGNREKISVKNNVPGISSGVVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYSNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSIAGFEGLQSGSIEHMEYNFLTAQPSSCSGNSKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDSVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTMVMCANCRARFSRNHDFM 1282          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A061FFY5_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_034889 PE=4 SV=1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 463/719 (64.39%), Postives = 538/719 (74.83%), Query Frame = -3
Query:  634 VETFTDKYNHEGNLLSRDEQDKVNMNEKVLADRNCDTKIKFCFVTDNKGDITDATAAADLNVCLGSESILFTSDKEGISRPSDKVDVGFAVNSMEEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILV-SGTLDDPESIMVNESANIEPTICFQSHLPMKKPSQEKSETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILASVKHEKTKDRLFGPSSYKKTHTCT-PEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPKHKGGSSIVGNAYARVGTFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFD-SVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHDFM 2778
            VET+TDK+++E N L R         EK LAD+ CD + KFC +T+NKG++TD TAA +LNVCLGSE + FT++  G+S+ SDKVDV  A++SMEEKKREMA N S LAPNA+GNMFSDEN E  HF SFLKGME D ++K   DDPKA CA+T T   +V ID  Q N SE C L  S N+QR NLVD++KGASVTIDS  E GSGCGL+SSK D++CVI+N+L L  +GTLDDPESI+V+ES N + TI FQ++  +KKPSQ+ SE+ LLT HGREQIFPSDNNAFK  SR VEVS+ D  Q   GL     S +SG+D NILASV+  KT+D LFGPSSYKKT T T  E KQ KGSES L++Q  NQQNS+ ETSMNKVSF + EEPKHK  SS++GNA+AR+G FALTGT QES SP  S N EK +GKNNVP I SG   EPKQNKGAFED F LS SEQT VANNL+M+HAGTAHD SRLQDF+NARNNEIMIG+ NHAR  E SMTGLTWKS+EG+VLLSGLADTSSQLL SSGYY TFD MSHKGE EMF++SGKCS++SGFEGL+S SIEHMEYN LTAQ SS                                          RSG+SKVPSY SEMAL FD S+WLGK+ALPLLPK+ GRHQVTTLCSWCGN+FY+EAVDI AQR++M VMCA+CRARFSRN DF+
Sbjct:  539 VETYTDKHSYECNFLFR---------EKTLADKTCDKQNKFCIITNNKGEVTD-TAAVELNVCLGSEKVFFTAESSGMSQSSDKVDVRLALHSMEEKKREMASNFSLLAPNAEGNMFSDENLEYRHFASFLKGMEPDCEEKVVGDDPKANCANTCTGPDSVTIDAEQQNCSESCLLTLSSNEQRGNLVDYVKGASVTIDSAREVGSGCGLTSSKDDKSCVINNNLFLAFTGTLDDPESIVVSESGNNDSTIGFQTNHRVKKPSQD-SESALLTLHGREQIFPSDNNAFKVSSRRVEVSEFDEIQKSSGLIQA-GSHDSGLDMNILASVRQAKTRDFLFGPSSYKKTFTSTVEECKQVKGSESSLHEQSANQQNSSKETSMNKVSFITIEEPKHKVESSLIGNAHARLGAFALTGTGQESSSPLSSENWEKFAGKNNVPCIGSGTFHEPKQNKGAFEDLFCLSGSEQTQVANNLSMIHAGTAHDRSRLQDFENARNNEIMIGFGNHARRTESSMTGLTWKSDEGSVLLSGLADTSSQLLQSSGYYSTFDVMSHKGEGEMFNVSGKCSNVSGFEGLRSDSIEHMEYNILTAQTSS------------------------------------------RSGDSKVPSYDSEMALTFDSSIWLGKEALPLLPKVDGRHQVTTLCSWCGNEFYHEAVDIEAQRNSMAVMCASCRARFSRNRDFL 1203          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A067LA57_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_15797 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 9.239e-50
Identity = 217/784 (27.68%), Postives = 353/784 (45.03%), Query Frame = -3
Query:  634 CDTKIKFCFVTDNKGD-ITDA--TAAADLNVCLGSESILFTSDKEGISRPSDKV--------------------------DVGFAVNSMEEK---------KREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAGCADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVD--HLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILV-SGTLDDPE---SIMVNESANIEPTICFQSH--LPMKKPSQEKSETVLLTSHG-----REQIFPSDNNA------------------------FKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNILA----SVKHEKTKDRLFGPSSYKKTHT---------CTPEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPKHK--------GGSSIVGNAYARVGTFALTGTVQESCSPH----FSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQT-HVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFD-SVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHDFM 2676
            CD +  F  + ++K D +T+     A ++NV  G+ES    ++ + I +PS +                           D  FAV++ E++          +E   ++  L+ N+       + T+D    S + GM++D K    ++  + G ++      +V  +  +    EG  +I S   Q+   VD  HL   S  +++TH+RGS  GL SS G++TCV ++ +  V + T++  +   S+M   SA     IC +S+  L M+ P        +  SH      +EQ+    NNA                        F + + T++VS+   A   +   P   +     D +++A     +  E+T + L   SS + T            +    QD+ SES L++   +    + E SMNKVS+   ++ KHK        G +    N++       +  T QESCS       SGN++K   ++N+ G+ +  + E    K   ++   LS SEQ   V NN +    G   + S L D+ N R  E ++G++ +A+  E++++G  W+++E N  LS  ADTSSQL+ SS Y+PT+D MS KGE+E+F    K +  +GF+G++S  +E+MEYNF+T                                              S S  SKV SY +E+    D SVWL K+ALPLLPKIA +     LC WC N+F+ EA++  AQ  +M   CA C+A+FS   + M
Sbjct:  601 CDKQDMFYSMNNDKEDKVTEVNDVIAVEINVFPGAESASLYNENDSIPKPSGETNFFQCATDTINTFGAQEEGSLPAVGRDRTFAVDNNEDQVCTSLKEDHSQERGSDSCSLSLNSVEKEV--DGTKDISVSSTINGMKIDEKVFLGKEKLRTGFSNDCLAKEDVANNIKEQRSCEGSLVIPSRIDQKNGPVDNAHLLSNSTVVENTHDRGSKGGLLSSLGEKTCVSNDKVNQVFTSTVNKSKFDKSVMSRNSAQ---KICLESNNMLAMEDPGILSELENISGSHSVVPSWKEQMCSFGNNASGTSICTRKKHCQENESEVIQLNLFGSENITMKVSNATMAVPNQNKVPLSKNSECCEDVDVVAGHATDIDLERTCNNLPVRSSNELTFASKDGGVLNGTSKNLMQDRISESSLHEPSCDGHAHDNENSMNKVSYIIMDQHKHKQFKSSCDVGPNIAFDNSHTEQHVDVVKSTTQESCSKDSSLVISGNQQKFDVEDNLTGLYTSTLNE---QKSPAKNLLSLSKSEQVWSVENNSSRDLTGRVQEESAL-DYLNPREKESLMGFSTYAQN-ENALSGFMWRTDEQNDPLSSFADTSSQLVHSSSYFPTYDVMSDKGESELF--GEKFNGTTGFDGVRSSGMENMEYNFMT----------------------------------------------SHSVGSKVFSYNAEITQGLDSSVWLEKEALPLLPKIASKRHTPALCVWCRNEFHYEALESEAQIGSMGFTCATCKAKFSGQFNLM 1326          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A067H079_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g002466mg PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.213e-43
Identity = 116/290 (40.00%), Postives = 156/290 (53.79%), Query Frame = -3
Query:  640 EKISG-KNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDS-VWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHD 1500
            EKI G  NN+  +S   +  PK     F++    +SSE      N   V   T   GSRL+D  NARNNE+M   +NH R   D +T L W+++E N+LLS L DTSS+LL SS     F  MS KG +E+FD   K  SISGFEG++ G+ E                                          H+EY+F+T QP   S  SKV SY +EM+  FDS VWL K+ALPLLPKI  RH+VTT+C+WC N+F++E +D   +  ++  MC  C+A+FS +H+
Sbjct:  262 EKIFGFDNNLTKVSVDKMEVPK-----FDEV--RNSSEHADGLKNNYRVDTCTVQ-GSRLEDSDNARNNELMSDISNHNRSGVDFVTQLLWRTDEENILLSSLTDTSSRLLQSSA----FGTMSDKGVSELFD--EKYDSISGFEGMRMGTTE------------------------------------------HLEYNFLTTQPGRHSEVSKVLSYDAEMSQGFDSSVWLEKEALPLLPKIGSRHRVTTVCAWCRNEFHHEPIDTGGETGSVGFMCPTCKAKFSGSHN 495          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A067GZT2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g002466mg PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.298e-43
Identity = 116/290 (40.00%), Postives = 156/290 (53.79%), Query Frame = -3
Query:  640 EKISG-KNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDS-VWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHD 1500
            EKI G  NN+  +S   +  PK     F++    +SSE      N   V   T   GSRL+D  NARNNE+M   +NH R   D +T L W+++E N+LLS L DTSS+LL SS     F  MS KG +E+FD   K  SISGFEG++ G+ E                                          H+EY+F+T QP   S  SKV SY +EM+  FDS VWL K+ALPLLPKI  RH+VTT+C+WC N+F++E +D   +  ++  MC  C+A+FS +H+
Sbjct:  290 EKIFGFDNNLTKVSVDKMEVPK-----FDEV--RNSSEHADGLKNNYRVDTCTVQ-GSRLEDSDNARNNELMSDISNHNRSGVDFVTQLLWRTDEENILLSSLTDTSSRLLQSSA----FGTMSDKGVSELFD--EKYDSISGFEGMRMGTTE------------------------------------------HLEYNFLTTQPGRHSEVSKVLSYDAEMSQGFDSSVWLEKEALPLLPKIGSRHRVTTVCAWCRNEFHHEPIDTGGETGSVGFMCPTCKAKFSGSHN 523          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: B9H725_POPTR (DNA-binding family protein OS=Populus trichocarpa GN=POPTR_0005s17160g PE=4 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 8.661e-43
Identity = 205/752 (27.26%), Postives = 313/752 (41.62%), Query Frame = -3
Query:  652 DNKGDITDAT--AAADLNVCLGSESILFTSDKEGISRPSDKVDV-GFAVNSM---------------------------EEKKREMALNTSFLAPNAKGNMFSDENTEDGHFPSFLKGMEVDLKDKATRDDPKAG-CADTSTELSNVRIDNVQGNYSEGCSLIASGNKQRVNLVDHLKGASVTIDSTHERGSGCGLSSSKGDQTCVISNSLILVSGTLDDP--------------------------ESIMVNESANIE---PTICF---QSHLP-----------MKKPSQEK-SETVLLTSHGREQIFPSDNNAFKAFSRTVEVSDLDGAQNYRGLSPGVNSRNSGVDPNI--LASVKHEKTKDRLFGPSSYKKTHTCTPEYKQDKGSESILXXXXXXXXXXXYETSMNKVSFFSKEEPK-HKGGSSIVGNAYARVG-------TFALTGTVQESCSPHFSGNREKISGKNNVPGISSGAVLEPKQNKGAFEDFFGLS-SSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFD-SVWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFS 2643
            D  G++ + T   AA+++VC  SE  L +++   I R SD+ +V  +  N +                           EE  +    ++  LAPNAK NMF+D+  ED +  S +  M +D  D   + +P  G CA  +    NV  +  +   SEGCS         V L++     S+ ++   E+       SSKGD T + +N   + +G L++                           +++++NE        P I F   Q HL            +++P QE+ SE  LLT  G EQ F    N  K    T+ V + +     +      N   S +D ++  + +++   +    F PS+   T     E   D                   E SMN++S  +  E K  +  +S  G      G          +TGTVQE C   F+GN+  ++ K+N  G  +G + E KQ   + E    LS  +    V  NL+    G+  +  R+++ +N++ +++   ++ H  P E   +   W++ E   L    ADT  Q + +SG++P +D +S KGE+E F        ISGFEGL+SG +E+MEYN LT                                          +Q SS S  SKV S  + +   FD SV L K  LP LPK A RH V  +C WCG +   EA +  AQ STM  MCA C ARFS
Sbjct:  590 DEVGEMNEVTDIVAAEISVC--SEPALLSNENNAIHRSSDETNVPKYCTNIIDDLDCSVAGDVRNLACINLNRVPPRLIEELNQGRGSDSGLLAPNAKENMFNDDIIEDRNCSSTIDNMVIDDWDADGKGEPITGSCAAIA---ENVAANLKEQRSSEGCS---------VGLLN-----SIAVEIMQEK-------SSKGDLTGIENNMNSVCTGMLNESKFDDVGKPGTNELTSVCRDNNTALVDDNVVINEQGKNHGGCPVIPFLNEQMHLAENNITGTPKCTIREPCQEEESEGGLLTISGNEQSFDLKGNVIKVSKGTINVVNHNEVLCLKN-----NEFGSEIDQSVQTVTNIQERSSNIFSFFPSTNGLTFASKDEQSHDD------------------ENSMNQLSCTTSAEDKLQEAKTSCNGELCIAFGDNCTEQDADIVTGTVQEICFL-FAGNQHTLTAKDNATGPFNGTMDELKQKMDSVESVLCLSGDAPMRSVEKNLHTAFTGSIQEEPRVKNTENSKKDDLGHDFSGHPGPNESVESEFVWRNEENGGLRCDFADTC-QPVQASGFFPLYDAVSDKGESEHF--GEAYGVISGFEGLKSGGMENMEYNLLT------------------------------------------SQVSSHSDESKVVSCDAVIPQGFDSSVCLEKGDLPFLPKNASRHHVPAVCVWCGREICQEAFESEAQTSTMGFMCAECAARFS 1246          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: A0A067GMM3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g002466mg PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.110e-42
Identity = 116/290 (40.00%), Postives = 156/290 (53.79%), Query Frame = -3
Query:  640 EKISG-KNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDS-VWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHD 1500
            EKI G  NN+  +S   +  PK     F++    +SSE      N   V   T   GSRL+D  NARNNE+M   +NH R   D +T L W+++E N+LLS L DTSS+LL SS     F  MS KG +E+FD   K  SISGFEG++ G+ E                                          H+EY+F+T QP   S  SKV SY +EM+  FDS VWL K+ALPLLPKI  RH+VTT+C+WC N+F++E +D   +  ++  MC  C+A+FS +H+
Sbjct:  684 EKIFGFDNNLTKVSVDKMEVPK-----FDEV--RNSSEHADGLKNNYRVDTCTVQ-GSRLEDSDNARNNELMSDISNHNRSGVDFVTQLLWRTDEENILLSSLTDTSSRLLQSSA----FGTMSDKGVSELFD--EKYDSISGFEGMRMGTTE------------------------------------------HLEYNFLTTQPGRHSEVSKVLSYDAEMSQGFDSSVWLEKEALPLLPKIGSRHRVTTVCAWCRNEFHHEPIDTGGETGSVGFMCPTCKAKFSGSHN 917          
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Match: V4TC46_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000205mg PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.736e-42
Identity = 116/290 (40.00%), Postives = 156/290 (53.79%), Query Frame = -3
Query:  640 EKISG-KNNVPGISSGAVLEPKQNKGAFEDFFGLSSSEQTHVANNLNMVHAGTAHDGSRLQDFQNARNNEIMIGYTNHARPIEDSMTGLTWKSNEGNVLLSGLADTSSQLLTSSGYYPTFDWMSHKGETEMFDISGKCSSISGFEGLQSGSIEHMEYNFLTAQPSSCSGNPKGQSEMFNISGKCSNESGLSDNLEHMEYSFMTAQPSSRSGNSKVPSYGSEMALKFDS-VWLGKDALPLLPKIAGRHQVTTLCSWCGNQFYNEAVDIAAQRSTM-VMCANCRARFSRNHD 1500
            EKI G  NN+  +S   +  PK     F++    +SSE      N   V   T   GSRL+D  NARNNE+M   +NH R   D +T L W+++E N+LLS L DTSS+LL SS     F  MS KG +E+FD   K  SISGFEG++ G+ E                                          H+EY+F+T QP   S  SKV SY +EM+  FDS VWL K+ALPLLPKI  RH+VTT+C+WC N+F++E +D   +  ++  MC  C+A+FS +H+
Sbjct:  684 EKIFGFDNNLTKVSVDKMEVPK-----FDEV--RNSSEHADGLKNNYRVDTCTVQ-GSRLEDSDNARNNELMSDISNHNRSGVDFVTQLLWRTDEENILLSSLTDTSSRLLQSSA----FGTMSDKGVSELFD--EKYDSISGFEGMRMGTTE------------------------------------------HLEYNFLTTQPGRHSEVSKVLSYDAEMSQGFDSSVWLEKEALPLLPKIGSRHRVTTVCAWCRNEFHHEPIDTGGETGSVGFMCPTCKAKFSGSHN 917          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 17
Match NameE-valueIdentityDescription
A0A0B0NFH0_GOSAR0.000e+0100.00Methyl-CpG-binding domain-containing protein 8 OS=... [more]
A0A0B0NKI0_GOSAR0.000e+0100.00Methyl-CpG-binding domain-containing protein 8 OS=... [more]
A0A0D2Q638_GOSRA0.000e+096.50Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FFY5_THECC0.000e+064.39Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
A0A067LA57_JATCU9.239e-5027.68Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
A0A067H079_CITSI1.213e-4340.00Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
A0A067GZT2_CITSI2.298e-4340.00Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
B9H725_POPTR8.661e-4327.26DNA-binding family protein OS=Populus trichocarpa ... [more]
A0A067GMM3_CITSI5.110e-4240.00Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4TC46_9ROSI5.736e-4240.00Uncharacterized protein OS=Citrus clementina GN=CI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0021360 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0021360 ID=g.arboreum_cottongen_reftransV1_0021360|Name=g.arboreum_cottongen_reftransV1_0021360|organism=Gossypium arboreum|type=contig|length=2780bp
GATATCTGAAAACTATGAAAACTGAAAAGCTACCTGATATCAAATACAAC
AGCATAAGAATTTTCACAACTACTCTTACAAGAAATCATCAAACAAATCC
AAGGGGACAGAGGAGGGGGAGGTCCCTAATGCTAATTGCTGATCTGCCTG
AACCCTAGTTTAGACTAACACAGCAATGGAAAAAACAAAATGCAGGGAGT
CAGTTTGTGATATACATACAAATGAACCAAGCCCCAAGCAGCATAATTGT
CAAAAAAGAGTAATTGCCGCACGAAACATTCAAATGCCTAGAAGTACAAC
AGAAGCTAAGGTTATGCGTCTCGGTTATTGCCCAAGTCAGTGTGTAATGA
TTTCTCAATTCTTGTGCTGGAAATGAAGAACTAACACAAGATTCTTGAAA
ATCAAATGTCAACTGATAAACTAGATGATTTGGACCAAGTGAAAAGGTTC
AATAGTGAAAGGCAAAACAAAAGTCGTACCAGAACTGCAAACTCTGCCTC
CTGAAATTAGAGAGGACGATAATTTGATCAACCTATAAGCACTAGTTCAG
CCTTCCAATTTGTTTCAGCTGCTGCCTTGTGTCATAGACTTGGGAATCAC
ACATGCTGGTATGCTTGTAAACATGCTATTTTACATAAAATCATGGTTCC
TAGAGAACCTAGCCCGACAGTTGGCACACATAACCATTGTGCTTCTCTGT
GCTGCGATATCAACAGCCTCATTATAAAACTGATTTCCACACCAGGAGCA
CAAGGTAGTGACCTGATGTCTGCCAGCTATTTTAGGCAACAGCGGCAAAG
CATCCTTTCCAAGCCACACAGAGTCAAACTTTAATGCCATCTCTGAACCA
TATGATGGTACCTTGGAGTTTCCTGAACGAGAACTTGGTTGAGCAGTCAT
AAAACTATATTCCATATGTTCCAAGTTATCTGATAAACCTGATTCATTGC
TGCACTTCCCACTAATGTTGAACATTTCACTTTGACCCTTGGGGTTCCCT
GAACAAGAACTTGGTTGAGCAGTCAGAAAATTATATTCCATATGTTCTAT
GCTACCAGATTGCAGCCCTTCAAAACCTGATATACTGCTGCACTTTCCAC
TAATGTCGAACATTTCAGTTTCACCCTTATGTGACATCCAGTCAAATGTG
GGGTAATAACCAGATGATGTCAACAATTGAGATGAAGTATCAGCCAAACC
ACTCAGCAGAACATTTCCTTCATTACTTTTCCATGTGAGCCCAGTCATGG
AATCCTCAATAGGTCGTGCATGATTGGTATAACCAATCATTATTTCATTA
TTCCTTGCATTCTGAAAATCTTGTAACCTAGACCCATCATGTGCTGTGCC
TGCATGAACCATGTTCAAATTATTTGCAACATGTGTTTGTTCACTACTGG
ATAGACCGAAGAAATCCTCAAAAGCACCTTTATTTTGCTTTGGTTCAAGA
ACAGCACCACTGCTAATACCAGGTACATTATTTTTACCAGAAATTTTTTC
CCTATTTCCAGAAAAATGTGGGGAACAGCTTTCCTGAACAGTGCCTGTCA
AAGCAAATGTGCCTACTCTAGCATAAGCATTTCCAACAATGGAGCTTCCC
CCTTTGTGTTTGGGCTCCTCTTTCGAAAAGAAAGAAACTTTGTTCATACT
AGTTTCATAGTTACTGTTTTGCTGATTACCATACTGTTGATAGAGAATGC
TCTCAGACCCTTTATCCTGTTTATACTCCGGTGTGCAAGTATGTGTTTTC
TTATATGAAGATGGGCCAAATAGACGATCTTTAGTCTTTTCATGTTTGAC
ACTAGCTAGGATGTTAGGATCCACTCCACTGTTACGGCTGTTCACACCCG
GACTTAATCCTCTATAATTTTGGGCTCCATCAAGGTCAGACACCTCCACC
GTCCGGCTGAAGGCCTTAAATGCATTATTGTCAGAAGGAAATATTTGCTC
CCTGCCATGTGAAGTAAGCAAGACTGTTTCACTTTTCTCTTGTGAGGGTT
TTTTCATGGGGAGATGGCTTTGAAAACAAATAGTAGGTTCAATGTTAGCG
GATTCATTGACCATAATAGATTCCGGATCATCTAAAGTGCCAGAAACAAG
AATCAAACTATTGCTGATGACACATGTTTGATCACCTTTAGACGAACTTA
AACCACATCCAGAACCTCTTTCATGTGTAGAATCTATTGTAACAGAAGCC
CCTTTCAAATGATCTACAAGATTAACTCTTTGTTTGTTGCCAGAAGCAAT
AAGTGAACAACCTTCACTGTAATTTCCCTGTACATTATCAATTCTGACAT
TAGACAGCTCTGTGCTAGTATCAGCACAACCAGCTTTTGGGTCATCCCTT
GTAGCTTTATCCTTCAAATCAACTTCCATCCCTTTCAAAAAGCTAGGAAA
ATGTCCATCCTCGGTATTTTCATCACTAAACATATTTCCCTTAGCATTTG
GAGCAAGGAAACTGGTGTTCAAAGCCATCTCTCTCTTCTTCTCCTCCATT
GAATTAACAGCAAATCCAACATCAACTTTATCTGAAGGTCGGGAAATCCC
TTCTTTGTCAGACGTAAACAAGATGCTTTCAGAACCCAAACAAACATTAA
GATCAGCAGCTGCAGTAGCATCAGTGATGTCCCCTTTATTATCAGTTACA
AAACAGAATTTAATTTTTGTATCACAGTTTCTGTCAGCTAACACTTTTTC
ATTCATGTTAACCTTATCCTGTTCATCACGAGACAATAAATTGCCTTCAT
GATTGTATTTATCAGTAAACGTTTCAACCA
back to top