g.arboreum_cottongen_reftransV1_0010388, g.arboreum_cottongen_reftransV1_0010388 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010388
Unique Nameg.arboreum_cottongen_reftransV1_0010388
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1961
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr10chromosomeg.arboreum_cottongen_reftransV1_0010388:1..1961 .
Chr10:15457357..15459952 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A0B0N7H7_GOSAR (Pectinesterase OS=Gossypium arboreum GN=F383_15550 PE=3 SV=1)

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 587/587 (100.00%), Postives = 587/587 (100.00%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPSSCFSSISSVASSNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNFVDGTATFDTATFTVAGRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL
Sbjct:    1 MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPSSCFSSISSVASSNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNFVDGTATFDTATFTVAGRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 587          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A0D2QGG4_GOSRA (Pectinesterase OS=Gossypium raimondii GN=B456_009G147800 PE=3 SV=1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 572/587 (97.44%), Postives = 581/587 (98.98%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPSSCFSSISS+ASSNA DP+ILFKLSLKV IDELSGLSQYPKKLQAETNN+QVKHALDVCGTVFDDALDRLNDSATSLEVG+GESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAK LGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHF+TINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKH+WNVMIYGDGKTKT ISGSRNFVDGTATFDTATFTVAGRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTI YAEYQNTGPGSTVDQRVKWAGYRS+L+EADAGKFTVANFIQG+DWLPAATVAYEPA 
Sbjct:    1 MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPSSCFSSISSIASSNANDPKILFKLSLKVAIDELSGLSQYPKKLQAETNNSQVKHALDVCGTVFDDALDRLNDSATSLEVGEGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKFLGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFKTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHKWNVMIYGDGKTKTTISGSRNFVDGTATFDTATFTVAGRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTIFYAEYQNTGPGSTVDQRVKWAGYRSSLTEADAGKFTVANFIQGQDWLPAATVAYEPAF 587          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A061GCS9_THECC (Pectinesterase OS=Theobroma cacao GN=TCM_029250 PE=3 SV=1)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 486/587 (82.79%), Postives = 534/587 (90.97%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSIKSFKGYGKVDE EE+AFKRKTRRRLIIL+ISI VL+AVII AVAG LIHKR+NSS +T  PT+LTPAASLK VC VTQYP+SCFSS+SS+ASSN +DPEILFKLSL+V I+ELS LSQYP KLQAETNNTQVK AL VCGT+F+DALDRL DSATSLEVG G+ LLS SKI+DLKTWLST ITDQETCLDALEELNTTK+FNATL EE+KAAMQNSSEYASNSLAI AKIL LL +F IPIHRRLLGFQ+   SEFP WVSPTERRLLQ+S PTPNV+VA+DGSG   TIN+AV+LVGKKN+SRFVIYVKEGKYVENV LDKH+WNVMIYGDGKTKTIISGS NFVDGT TF TATF V G+GFIAK I+F N+AGAAKHQAVAMRSGSDRSVFY CAFDA+QDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPL NQFNTITAQGKKDPNQN+G+S+QKCT++ FGNLTANTYLGRPWKE+STTVIMQS IGAFLNP+GW+EWV+NVDPPS+I YAEY+N+GPGS VD+RVKW GYR TLS+ DAGKFTV  FIQGE+WLP ATV+Y+PAL
Sbjct:    1 MDSIKSFKGYGKVDELEEQAFKRKTRRRLIILIISIAVLIAVIIAAVAGILIHKRSNSSSNTVPPTDLTPAASLKTVCSVTQYPTSCFSSLSSMASSNTSDPEILFKLSLEVAINELSKLSQYPSKLQAETNNTQVKSALQVCGTLFEDALDRLTDSATSLEVGQGQRLLSASKINDLKTWLSTTITDQETCLDALEELNTTKHFNATLLEEVKAAMQNSSEYASNSLAIVAKILSLLPDFNIPIHRRLLGFQETG-SEFPDWVSPTERRLLQDSNPTPNVVVAQDGSGDVLTINDAVKLVGKKNESRFVIYVKEGKYVENVILDKHQWNVMIYGDGKTKTIISGSLNFVDGTPTFATATFAVTGKGFIAKGIQFVNSAGAAKHQAVAMRSGSDRSVFYQCAFDAFQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLANQFNTITAQGKKDPNQNSGMSVQKCTLSAFGNLTANTYLGRPWKEYSTTVIMQSEIGAFLNPLGWKEWVSNVDPPSSIFYAEYKNSGPGSNVDERVKWGGYRPTLSDVDAGKFTVGTFIQGEEWLPGATVSYQPAL 586          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A0D2VBM0_GOSRA (Pectinesterase OS=Gossypium raimondii GN=B456_010G173200 PE=3 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 477/587 (81.26%), Postives = 519/587 (88.42%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSI SFKGYGKVDE EE AF+RK RRRLI L+I I++LL +I  AV G  +HKR++SSP+T  P  LTPAASLKAVC VTQYP+SCFSSISS+A SN T PE+LFKLSLKV IDELS LS YP KL+AETN+ ++K AL VC T+FDDALDRLNDSATSLEVG+GE LLSDSKI DLKTWLST ITDQETCLD+LEELN TK+FNAT+ EE+KAAMQNS+EYASNSLAI A+ILGLLT+  I IHRRLLGF+KA  SEFPAWVSPTERRLLQESKPTPNVIVA+DGSG+  TIN+AV+LVGKKN+SRFVIYVKEGKYVENV LDKH WNVMIYGDGKTKT+ISGS NFVDGT TF TATF VAG+GFIAK I F NTAGAAKHQAVAMRSGSDRSVFY CAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQ+CNI PRQPL NQFNTITAQGKKDPNQNTGI IQKC+I+ FGNLTA TYLGRPWKEFSTTVIMQS IGAFL+PVGW+ WV NVDPP +I YAEYQN+GPGS VD RVKWAGYRSTLS+ DAGKFTV  FIQG DWLP ATV+YEPAL
Sbjct:    1 MDSINSFKGYGKVDEVEELAFRRKKRRRLITLIILILLLLTLITAAVVGIFLHKRSSSSPNTLPPPVLTPAASLKAVCSVTQYPASCFSSISSIAPSNTTVPELLFKLSLKVAIDELSSLSHYPTKLKAETNDIRLKSALQVCETMFDDALDRLNDSATSLEVGEGEKLLSDSKISDLKTWLSTAITDQETCLDSLEELNATKHFNATVVEEMKAAMQNSTEYASNSLAIVARILGLLTDLNIRIHRRLLGFEKAG-SEFPAWVSPTERRLLQESKPTPNVIVAQDGSGNVLTINDAVKLVGKKNESRFVIYVKEGKYVENVILDKHMWNVMIYGDGKTKTLISGSHNFVDGTPTFATATFAVAGKGFIAKGIGFINTAGAAKHQAVAMRSGSDRSVFYRCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQSCNILPRQPLANQFNTITAQGKKDPNQNTGICIQKCSISAFGNLTAKTYLGRPWKEFSTTVIMQSKIGAFLDPVGWKGWVANVDPPISIFYAEYQNSGPGSNVDNRVKWAGYRSTLSDVDAGKFTVETFIQGHDWLPNATVSYEPAL 586          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A0B0PU67_GOSAR (Pectinesterase OS=Gossypium arboreum GN=F383_12686 PE=3 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 477/587 (81.26%), Postives = 519/587 (88.42%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSI SFKGYGKVDE EE AF+RK RRRLI L+I I++LL +I  AV G  +HKR++SSP+T  P  LTPAASLKAVC VTQYP+SCFSSISS+ASSN TDPE+LFKLSLKV IDELS LS YP KL+AETN+ Q+K AL VC T+FDDALDRLN+SATSLEVG+GE LLSDSKI DLKTWLST ITDQETCLD+L+ELN TK+FNAT+ EE+KAAMQNS+EYASNSLAI A+ILGLLT+  I IHRRLLG +KA  SEFPAWVSPTERRLLQESKPTPNVIVA+DGSG+  TIN+AV+LVGKKN+SRFVIYVKEGKYVENV LDKH WNVMIYGDGKTKT+ISGS NFVDGT TF TATF VAG+GFIAK I F NTAGAAKHQAVAMRSGSDRSVFY CAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQ+CNI PRQPL NQFNTITAQGKKDPNQNTGI IQKC+IT FGNLTA TYLGRPWKEFSTTVIMQS IGA L+PVGW+ WV NVDPP +I YAEYQN+GPGS VD RVKWAGYRSTLS+ DAGKFTV  FIQG DWLP ATV+YEPAL
Sbjct:    1 MDSINSFKGYGKVDEVEELAFRRKKRRRLITLIILILLLLTLITAAVVGIFLHKRSSSSPNTLPPPVLTPAASLKAVCSVTQYPASCFSSISSIASSNTTDPELLFKLSLKVAIDELSRLSHYPTKLKAETNDIQLKSALQVCETMFDDALDRLNNSATSLEVGEGEKLLSDSKIGDLKTWLSTAITDQETCLDSLDELNATKHFNATVVEEMKAAMQNSTEYASNSLAIVARILGLLTDLNIRIHRRLLGLEKAG-SEFPAWVSPTERRLLQESKPTPNVIVAQDGSGNVLTINDAVKLVGKKNESRFVIYVKEGKYVENVILDKHMWNVMIYGDGKTKTLISGSHNFVDGTPTFATATFAVAGKGFIAKSIGFINTAGAAKHQAVAMRSGSDRSVFYRCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQSCNILPRQPLANQFNTITAQGKKDPNQNTGICIQKCSITAFGNLTAKTYLGRPWKEFSTTVIMQSKIGALLDPVGWKGWVANVDPPISIFYAEYQNSGPGSNVDNRVKWAGYRSTLSDIDAGKFTVETFIQGHDWLPNATVSYEPAL 586          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: B9T3X6_RICCO (Pectinesterase OS=Ricinus communis GN=RCOM_0417590 PE=3 SV=1)

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 420/590 (71.19%), Postives = 507/590 (85.93%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNN-SSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETN-NTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFG-NLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSI SFKGYGKVDE E++A++RKTR+RLIIL++S IVL+A+IIGAV GT+IHKRNN SSP++A PTELTPAASLKAVC VTQ+PSSCFSSISS+ ++N +DPE+LFKLSL VVI+ELS +  YP KL   +N +  VK AL+VC +VFDDA D LNDS +S+ VG+GE++LS SKI+D+KTWLST ITDQETCLDAL+ELN TK+F++ + E+++ AM+NS+E+ASNSLAI AKI+GLLT+F IPIHR+LLGF++ + S FP+WVS  +RRLLQE+KP  NV VAKDGSG + TI EAV  + KK+ SRF+I+VKEG YVEN+ +DKH+WNVMIYGDGK KTIISGS NFVDGT TF TATF VAG+GF+A+DIKF NTAGAAKHQAVA RSGSD SV++ C+FDAYQDTLYAHSNRQFYR+CDI GTIDFIFGNAAVVFQNCNI PRQPLPNQFNTITAQGKKDPNQNTGISIQKC    FG NLTA+TYLGRPWK FSTTVIMQSNI +FLNP+GW  WV+ +DPPS+I Y EYQNTGPGS +++R++W GY+ +L+E +AGKF+V +FIQG DWLPA +V ++ +L
Sbjct:    1 MDSINSFKGYGKVDELEQQAYRRKTRKRLIILIVSFIVLVAIIIGAVVGTVIHKRNNDSSPNSAVPTELTPAASLKAVCSVTQFPSSCFSSISSLETANTSDPEVLFKLSLHVVINELSKIKDYPSKLIQNSNLDATVKAALNVCESVFDDAFDMLNDSISSMTVGEGETILSPSKINDMKTWLSTTITDQETCLDALQELNGTKHFDSKVLEDIRTAMENSTEFASNSLAIVAKIIGLLTDFNIPIHRKLLGFERTS-SGFPSWVSIGDRRLLQEAKPAANVTVAKDGSGDYTTIGEAVDAIPKKSPSRFIIHVKEGTYVENILMDKHKWNVMIYGDGKDKTIISGSTNFVDGTPTFSTATFAVAGKGFMARDIKFINTAGAAKHQAVAFRSGSDMSVYFQCSFDAYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQNCNIMPRQPLPNQFNTITAQGKKDPNQNTGISIQKCKFYAFGPNLTASTYLGRPWKNFSTTVIMQSNIDSFLNPLGWMSWVSGIDPPSSIFYGEYQNTGPGSAIEKRIQWVGYKPSLTEVEAGKFSVGSFIQGTDWLPATSVTFDSSL 589          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A067L073_JATCU (Pectinesterase OS=Jatropha curcas GN=JCGZ_24627 PE=3 SV=1)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 419/589 (71.14%), Postives = 494/589 (83.87%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNN-SSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFG-NLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSI SFKGYGKVDE EE+AFKRKTR+RLIIL+++ +VL+AVIIGAV GT++HKRNN SS D+ +PTELTPAASLKAVC VTQYP+SCFSSIS++ ++N TDPEILFKLSL+V ++ELS L  YP KL    N+  +K AL VC +VFDDA+DRLNDS +S+ VGDGE +LS +KI+D+KTWLS VITDQETCLDAL+ELN+TK+FN+TL E+++  M NS+E+ASNSLAI AKILGLL++  IPIHR+LLG +++  S FP WVS  +RRLLQESKPTPNV VAKDGSG + TI  AV  + KK+ SRF+IYVKEG YVEN+ LDKH+WNVMIYGDGK KTIISGS+NFVDGT TF TATF V G+GF+A+DIKF NTAGAAKHQAVA RSGSD SV+Y CAFDAYQDTLYAHSNRQFYRECD+ GTIDFIFGNAAVVFQ CNIQPRQPLPNQFNTITAQGKKDPNQNTGIS+Q C I  FG  LTA TYLGRPWK FSTTVIMQ++I   ++P GW  WV+ VDPPSTI Y EY NTG G+ V++RV WAGY+ +L+E +A +FTV +FIQG +WLP ATV ++  L
Sbjct:    1 MDSINSFKGYGKVDEPEEQAFKRKTRKRLIILIVASVVLVAVIIGAVVGTVLHKRNNESSTDSVAPTELTPAASLKAVCRVTQYPASCFSSISALETANTTDPEILFKLSLRVAMNELSRLKDYPSKLIQTANDATLKAALSVCDSVFDDAVDRLNDSVSSMAVGDGEKILSTAKINDMKTWLSAVITDQETCLDALQELNSTKHFNSTLLEDVRKTMVNSTEFASNSLAIVAKILGLLSDINIPIHRKLLGSERSN-SGFPGWVSLGDRRLLQESKPTPNVTVAKDGSGDYTTIGAAVGAIPKKSLSRFIIYVKEGTYVENILLDKHKWNVMIYGDGKDKTIISGSKNFVDGTPTFSTATFAVTGKGFMARDIKFINTAGAAKHQAVAFRSGSDMSVYYQCAFDAYQDTLYAHSNRQFYRECDVTGTIDFIFGNAAVVFQKCNIQPRQPLPNQFNTITAQGKKDPNQNTGISVQNCKIYAFGATLTATTYLGRPWKNFSTTVIMQTDIDRLVSPAGWMPWVSGVDPPSTIFYGEYMNTGSGANVEKRVTWAGYKPSLTEDEASRFTVGSFIQGPEWLP-ATVTFDSTL 587          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: B9GXZ7_POPTR (Pectinesterase OS=Populus trichocarpa GN=POPTR_0003s07030g PE=3 SV=1)

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 412/588 (70.07%), Postives = 492/588 (83.67%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNN-SSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSI SFKGYGKVDEAE++AF++K+R+RLII+V+S IVLLAVIIGAV G ++HKRNN SS +   P ELTPA SLKAVC VTQYP+SCFSSIS++ + N TDPE+LFKLSL+V ++ELS L  YP KL     +T ++ AL VC TVFDDA+DRLNDS +S+ +G+GE +LS +K++DLKTWLS  ITDQETCLDAL+EL+TTK+FN TL +++K AM+NS+E+ SNSLAI AKILGLL++F+IPIHRRLLGF+++  SEFP WVS  +RRLLQESKPTPNV VAKDGSG   T+ EAV  + KK++S+F+I+VKEG YVENV LDK +WNVMIYG+GK KTI+SGS NFVDGT TF T TF VAG+GF A+D+KF NTAGA KHQAVA RSGSD SVFY CAFDA+QDTLYAHSNRQFYR+CDI GTIDFIFGNAAVVFQNCNIQPRQPL NQFNTITAQGKKDPNQNTGISIQKC  + F N+TA TYLGRPWK++STTVIMQS+IG+FL P+GW  WV+ VDPP+TI YAEYQNTG G+ VD RVKW GY+  L+  +AGKF V +FIQG +WLP  +V ++  L
Sbjct:    1 MDSINSFKGYGKVDEAEQQAFRKKSRKRLIIIVVSSIVLLAVIIGAVIGAVVHKRNNKSSSNPVPPPELTPATSLKAVCSVTQYPASCFSSISALETGNTTDPEVLFKLSLRVAMNELSKLKDYPDKLIQSIKDTTLQGALKVCATVFDDAVDRLNDSISSMAIGEGEQILSPAKMNDLKTWLSATITDQETCLDALQELSTTKHFNQTLVDQVKTAMENSTEFVSNSLAIVAKILGLLSDFKIPIHRRLLGFERSHISEFPQWVSFGDRRLLQESKPTPNVTVAKDGSGDCETLREAVGKIPKKSESKFIIHVKEGVYVENVILDKSKWNVMIYGEGKDKTIVSGSLNFVDGTPTFSTPTFAVAGKGFFARDMKFINTAGAEKHQAVAFRSGSDMSVFYRCAFDAFQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQNCNIQPRQPLANQFNTITAQGKKDPNQNTGISIQKCKFSAFDNVTAPTYLGRPWKDYSTTVIMQSDIGSFLRPLGWISWVSGVDPPATIFYAEYQNTGSGANVDGRVKWTGYKPALTVDEAGKFAVDSFIQGSEWLPKTSVTFQSML 588          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: F6HXK9_VITVI (Pectinesterase OS=Vitis vinifera GN=VIT_09s0002g00330 PE=3 SV=1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 408/590 (69.15%), Postives = 483/590 (81.86%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHK---RNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MDSIKSFKGYGKVDE EERAFKRKTR+RLIIL+IS +VL+AVIIGAVAGTLIHK    +NS P  ASP  ++PA S+KAVC VTQYP SC SSISS+ +SN TDPE LF+L+L+V I ELS LS  P++L A++N+ Q+K AL VC TVF+DA+DRLNDS +S+EV +GE LLS SKIDD+KTWLS  ITDQETCLDALEELN+T      L  E+K AMQNS+ +ASNSLAI AK++G+L +  I +HR+LL F  +   +FP WV   ERRLLQE+KPTP+V VAKDG+G + TI EAV +V KK++ RFVIYVKEG Y EN+ LDK +WNVMIYGDGK K+I+SG+ NF+DGT TF TATF   G+GFIAK ++FENTAGAAKHQAVA RSGSD SVFY C+FDA+QDTLYAHSNRQFYRECDI GTIDFIFGNAAVVFQ C IQPRQP+ NQFNTITAQGKKDPNQNTGISIQKC+I+    LTA TYLGRPWK +STT++MQSNIG+FLNP GW EWVT VDPPSTI YAE+QNTGPG+T+DQRVKWAG+ + ++E +A KFTV  FIQG  WL  ++V ++ +L
Sbjct:    1 MDSIKSFKGYGKVDELEERAFKRKTRKRLIILIISSVVLVAVIIGAVAGTLIHKSKSESNSVP--ASP--VSPATSIKAVCSVTQYPDSCVSSISSLDTSNTTDPEELFRLTLRVAIAELSKLSSLPRQLSAKSNDAQLKKALGVCETVFEDAIDRLNDSISSMEVREGEKLLSASKIDDIKTWLSATITDQETCLDALEELNST------LLNEVKTAMQNSTVFASNSLAIVAKLIGILHDLDIQVHRKLLSFSNS--DQFPDWVGAGERRLLQETKPTPDVTVAKDGTGDYVTIKEAVAMVPKKSEKRFVIYVKEGNYSENIILDKSKWNVMIYGDGKDKSIVSGNLNFIDGTPTFATATFAAVGKGFIAKYMRFENTAGAAKHQAVAFRSGSDMSVFYQCSFDAFQDTLYAHSNRQFYRECDITGTIDFIFGNAAVVFQACKIQPRQPMSNQFNTITAQGKKDPNQNTGISIQKCSISALNTLTAPTYLGRPWKAYSTTIVMQSNIGSFLNPKGWTEWVTGVDPPSTIFYAEFQNTGPGATLDQRVKWAGFMTNITEDEAAKFTVGTFIQGASWLSESSVTFDASL 578          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Match: A0A067ES96_CITSI (Pectinesterase OS=Citrus sinensis GN=CISIN_1g007830mg PE=3 SV=1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 404/590 (68.47%), Postives = 476/590 (80.68%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHK-RNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNAT-DPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGN-LTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            M++I+SFKGYGKVDE E++AF+RKTR+R+IIL+IS IVL+AVIIGAV G ++HK +N+SS D    T+LTPAASLKAVC VT+YP SCFSSISS+ +SN T DPEILFKLSL+V ++EL  L  YP KL+ +T + QV  AL VC T+FDDALD +N+S +S++VG GE LLS  KI DLKTWLST ITDQ+TCLDAL+ELN +   N+ + +++++AMQNSSE+ASNSLAI +K+LGLL    IP+HRRLL     + S FP WV   +RRLLQE+ P P+  VA+DGSG + TI  AV  V KK+ +RFVIYVK+G Y ENV LDK RWNVM+YGDGKT TI+SGS NFVDGT TF TAT  VAGRGFIAKD+ F NTAG  KHQAVA RSGSDRSVFY C+F+AYQDTLYAHSNRQFYR+CDI GTIDFIFGNAAVVFQNCNI PRQPLPNQFNTITAQGKKDPNQNTGISIQKCT++ F + LTA TYLGRPWKEFSTTVIMQS IG FLN +GW+EWV+ VDPP++I YAEYQN G GS    RVKWAGYR TL+  +A KFTV NFIQG +WL  A V Y+ +L
Sbjct:    1 METIRSFKGYGKVDELEQQAFRRKTRKRVIILIISSIVLVAVIIGAVIGVVVHKNKNDSSSDNMPATQLTPAASLKAVCSVTRYPDSCFSSISSIDASNVTKDPEILFKLSLQVAMNELGKLQNYPSKLKQQTKDPQVIEALKVCETLFDDALDHVNESLSSMQVGSGEKLLSSKKIQDLKTWLSTSITDQDTCLDALQELNVSHYQNSNILKDIRSAMQNSSEFASNSLAIGSKVLGLLGKVDIPVHRRLLS--DHSDSGFPNWVGAGDRRLLQEANPKPDATVAQDGSGDYDTIKAAVAAVRKKSPTRFVIYVKKGTYRENVILDKSRWNVMMYGDGKTMTIVSGSLNFVDGTPTFATATVAVAGRGFIAKDMTFINTAGPEKHQAVAFRSGSDRSVFYRCSFNAYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQNCNILPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTLSRFDDKLTAATYLGRPWKEFSTTVIMQSTIGPFLNALGWKEWVSGVDPPTSIFYAEYQNVGLGSPTSGRVKWAGYRPTLTTDEAAKFTVGNFIQGSEWLAEANVQYQESL 588          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME3_PHAVU (Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1)

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 387/595 (65.04%), Postives = 477/595 (80.17%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASP---TELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAET-NNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIH-RRLLGFQKAAPSEFPAWVSPTERRLLQE--SKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFG-NLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            MD+IKSFKGYGKV+E E++A+++KTR+RLII+ +S IVL+AVII AVAG +IH RN+ S  ++     TEL+PAASLKAVC+ T+YPSSCFSSISS+  SN TDPE+LFKLSL+V IDELS    +P KL+A    + +++ A+DVC +VF DALDRLNDS ++L    G  + S + + +++TWLS  +TDQ+TCLDA+ ELN+T    A   +E++ AM+NS+E+ASNSLAI  KILGLL+ F  PIH RRLLGF        P W+   ERRLL+E  +  TP+ +VAKDGSG F+TI EA++LV KK++ RF +YVKEG+YVEN++LDK+ WNVMIYGDGK KT + GSRNF+DGT TF+TATF V G+GFIAKDI F N AGA+KHQAVA+RSGSDRSVF+ C+FD +QDTLYAHSNRQFYR+CDI GTIDFIFGNAAVVFQ+C I PRQPLPNQFNTITAQGKKDPNQNTGI IQK TITPFG NLTA TYLGRPWK+FSTTVIMQS+IGA LNPVGW  WV NV+PP+TI YAEYQN+GPG+ V QRVKWAGY+ T+++ +A +FTV +FIQG +WLP A V ++  L
Sbjct:    1 MDTIKSFKGYGKVNELEQQAYEKKTRKRLIIIAVSSIVLIAVIIAAVAGVVIHNRNSESSPSSDSVPQTELSPAASLKAVCDTTRYPSSCFSSISSLPESNTTDPELLFKLSLRVAIDELS---SFPSKLRANAEQDARLQKAIDVCSSVFGDALDRLNDSISALGTVAGR-IASSASVSNVETWLSAALTDQDTCLDAVGELNSTAARGA--LQEIETAMRNSTEFASNSLAIVTKILGLLSRFETPIHHRRLLGF--------PEWLGAAERRLLEEKNNDSTPDAVVAKDGSGQFKTIGEALKLVKKKSEERFSVYVKEGRYVENIDLDKNTWNVMIYGDGKDKTFVVGSRNFMDGTPTFETATFAVKGKGFIAKDIGFVNNAGASKHQAVALRSGSDRSVFFRCSFDGFQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQSCKIMPRQPLPNQFNTITAQGKKDPNQNTGIIIQKSTITPFGNNLTAPTYLGRPWKDFSTTVIMQSDIGALLNPVGWMSWVPNVEPPTTIFYAEYQNSGPGADVSQRVKWAGYKPTITDRNAEEFTVQSFIQGPEWLPNAAVQFDSTL 581          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME1_ARATH (Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 PE=1 SV=1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 361/586 (61.60%), Postives = 450/586 (76.79%), Query Frame = 1
Query:   58 MDSIKSFKGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHK-RNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEEL--NTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRR--LLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATV 1800
            MDS+ SFKGYGKVDEA++ A K+KTR+RL++L IS++VL+AVII AV  T++HK +N S+P  + P ELTP+ SLKA+C VT++P SC SSIS + SSN TDPE LFKLSLKV+IDEL  +S  P+KL  ET + ++K AL VCG + +DALDRLND+ ++++  + +  LS SKI+DLKTWLS  +TD ETC D+L+EL  N T+  N+T+ + LK+AM  S+E+ SNSLAI +KIL  L++  IPIHRR  L+        +F  W     RRLLQ +   P+V VA DG+G   T+NEAV  V KK+   FVIYVK G YVENV +DK +WNVMIYGDGK KTIISGS+NFVDGT T++TATF + G+GFI KDI   NTAGAAKHQAVA RSGSD SV+Y C+FD +QDTLY HSNRQFYR+CD+ GTIDFIFG+AAVVFQ C I PRQPL NQFNTITAQGKKDPNQ++G+SIQ+CTI+  GN+ A TYLGRPWKEFSTTVIM++ IGA + P GW  WV+ VDPP++I+Y EY+NTGPGS V QRVKWAGY+  +S+A+A KFTVA  + G DW+PA  V
Sbjct:    1 MDSVNSFKGYGKVDEAQDLALKKKTRKRLLLLSISVVVLIAVIIAAVVATVVHKNKNESTP--SPPPELTPSTSLKAICSVTRFPESCISSISKLPSSNTTDPETLFKLSLKVIIDELDSISDLPEKLSKETEDERIKSALRVCGDLIEDALDRLNDTVSAIDDEEKKKTLSSSKIEDLKTWLSATVTDHETCFDSLDELKQNKTEYANSTITQNLKSAMSRSTEFTSNSLAIVSKILSALSDLGIPIHRRRRLMSHHHQQSVDFEKWA---RRRLLQTAGLKPDVTVAGDGTGDVLTVNEAVAKVPKKSLKMFVIYVKSGTYVENVVMDKSKWNVMIYGDGKGKTIISGSKNFVDGTPTYETATFAIQGKGFIMKDIGIINTAGAAKHQAVAFRSGSDFSVYYQCSFDGFQDTLYPHSNRQFYRDCDVTGTIDFIFGSAAVVFQGCKIMPRQPLSNQFNTITAQGKKDPNQSSGMSIQRCTISANGNVIAPTYLGRPWKEFSTTVIMETVIGAVVRPSGWMSWVSGVDPPASIVYGEYKNTGPGSDVTQRVKWAGYKPVMSDAEAAKFTVATLLHGADWIPATGV 581          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME26_ARATH (Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana GN=PME26 PE=2 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 301/541 (55.64%), Postives = 381/541 (70.43%), Query Frame = 1
Query:  211 IHKRNN-SSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXX-XXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLE--VGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIH-RRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVD-PPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGED-WLPAATVAYEP 1812
            IH+R+   SP        TP++ L+ VC VT YP+SC SSIS +  S   TDP++LF+LSL+V  DEL+ +   PKKL  ETN+  +K AL VC  VFD A+D +ND+ +SL+  +  G+  L+ S I DL TWLS+ +TD  TC D L+E     N+N+ + ++LK+AM NS+E+ SNSLAI A++L   +  RIP+  RRLL       + FP WV P  RRLLQ    TP+V VA DGSG  RT+NEAV  V KK ++ FVIYVK G YVENV + K +WNV IYGDG+ KTIISGS N VDG  TF+T+TF   G+GF+ KD+   NTAG  KHQAVA RS SDRSV+Y C+FD YQDTLY HSNRQ+YR CD+ GT+DFIFG   VVFQ C+I+PRQPLPNQFNTITA+G ++ NQNTGISI +CTI+P GN+TA TYLGRPWK FS TVIMQS IG+F+NP GW  W +  D PP TI Y EY+N+GPGS + +RVKWAGY+   S+ +A +FTV  F++G+D W+P A +   P
Sbjct:  436 IHERHGVQSPRLRKSPHPTPSSVLRTVCNVTNYPASCISSISKLPLSKTTTDPKVLFRLSLQVTFDELNSIVGLPKKLAEETNDEGLKSALSVCADVFDLAVDSVNDTISSLDEVISGGKKNLNSSTIGDLITWLSSAVTDIGTCGDTLDE----DNYNSPIPQKLKSAMVNSTEFTSNSLAIVAQVLKKPSKSRIPVQGRRLLN-----SNSFPNWVRPGVRRLLQAKNLTPHVTVAADGSGDVRTVNEAVWRVPKKGKTMFVIYVKAGTYVENVLMKKDKWNVFIYGDGRDKTIISGSTNMVDGVRTFNTSTFATEGKGFMMKDMGIINTAGPEKHQAVAFRSDSDRSVYYRCSFDGYQDTLYTHSNRQYYRNCDVTGTVDFIFGAGTVVFQGCSIRPRQPLPNQFNTITAEGTQEANQNTGISIHQCTISPNGNVTATTYLGRPWKLFSKTVIMQSVIGSFVNPAGWIAWNSTYDPPPRTIFYREYKNSGPGSDLSKRVKWAGYKPISSDDEAARFTVKYFLRGDDNWIPKAVMGMPP 967          

HSP 2 Score: 219.164 bits (557), Expect = 2.474e-59
Identity = 138/266 (51.88%), Postives = 186/266 (69.92%), Query Frame = 1
Query:   58 MDSIKSF-KGYGKVDEAEERAFKRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKR--NNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIH-RRLLGFQ-KAAPSEFP 840
            MD++KS  KGYGKVDE ++ A KRKTR+RL  + IS+ VL+A+II +     IH R  N+  P  +S  ELTPAASLK VC VT YP SCFSSIS +  SN TDPE++F+LSL+VVIDEL+ + + PKKL  ET++  +K AL VC  + D A+DR+N++ +++EV DG+ +L+ + IDDL TWLS  +T   TCLDAL+E++ T   N+ +  +LK+ M NS+E+ SNSLAI AKIL  +++F IPIH RRLL     A P   P
Sbjct:    1 MDTVKSINKGYGKVDETQDLALKRKTRKRLYQIGISVAVLVAIIISSTVTIAIHSRKGNSPHPTPSSVPELTPAASLKTVCSVTNYPVSCFSSISKLPLSNTTDPEVIFRLSLQVVIDELNSIVELPKKLAEETDDEGLKSALSVCEHLLDLAIDRVNETVSAMEVVDGKKILNAATIDDLLTWLSAAVTYHGTCLDALDEISHT---NSAIPLKLKSGMVNSTEFTSNSLAIVAKILSTISDFGIPIHGRRLLNSSPHATPISVP 263          

HSP 3 Score: 177.178 bits (448), Expect = 4.138e-45
Identity = 117/243 (48.15%), Postives = 160/243 (65.84%), Query Frame = 1
Query:  202 GTLIHKRN--NSSPDTASPT---ELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSL-EVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEEL--NTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIV 906
            G  IH R   NSSP  A+P    +LTPAASL+ VC VT+YP+SC SSIS + SSN TDPE LF+LSL+VVI+EL+ ++  PKKL  ET++ ++K +L VCG VF+DA+D +ND+ +++ EVGDG+ +L  S ID+++TWLS  +TD +TCLDAL+EL  N T+  N+ +  +LK+AM NS ++ SNSLAI AK          PIH R  G Q           SP   RL +   PTP+ ++
Sbjct:  242 GIPIHGRRLLNSSPH-ATPISVPKLTPAASLRNVCSVTRYPASCVSSISKLPSSNTTDPEALFRLSLQVVINELNSIAGLPKKLAEETDDERLKSSLSVCGDVFNDAIDIVNDTISTMEEVGDGKKILKSSTIDEIQTWLSAAVTDHDTCLDALDELSQNKTEYANSPISLKLKSAMVNSRKFTSNSLAIIAK---------FPIHER-HGVQ-----------SP---RLRKSPHPTPSSVL 459          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME46_ARATH (Probable pectinesterase/pectinesterase inhibitor 46 OS=Arabidopsis thaliana GN=PME46 PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.595e-146
Identity = 282/585 (48.21%), Postives = 381/585 (65.13%), Query Frame = 1
Query:   85 YGKVDEAEERAFK--RKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHA----LDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLL--GFQKAAPSEFPAWVSPTERRLLQES--KPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLT-ANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAY 1806
            YG++DE E+   +  RKT++R+ I+ IS IVL+ +++GAV GT   + N+  P T +  E   + S+KA+C+VT +   CF ++ S  +++ + PE LFK ++KV I ELS      K L   +N   + +A    +  C  +   A+D+LN++ TS          S    DDL+TWLS+V T QETC+DAL E N     + T F E    ++NS+E  SN+LAI    LG + +      RRLL  G  K   ++ P       RRLL+    K    ++VAKDGSG +RTI EA+  V +KN+   +IYVK+G Y+ENV ++K +WNV++ GDG++KTI+S   NF+DGT TF+TATF V G+GF+A+D+ F NTAG AKHQAVA+   +D SVFY C  DA+QDT+YAH+ RQFYR+C ILGT+DFIFGNAAVVFQ C I PR+P+  Q NTITAQG+KDPNQNTGISI  CTI P  NLT   T+LGRPWK+FSTTVIM+S +  F+NP GW  W T    P TI YAEY N+GPG++   RVKW G +++L++ +A KFTV  FI G +WLPA  V +
Sbjct:    4 YGRLDEHEQAKLEASRKTKKRIAIIAISSIVLVCIVVGAVVGT-TARDNSKKPPTENNGEPI-SVSVKALCDVTLHKEKCFETLGSAPNASRSSPEELFKYAVKVTITELS------KVLDGFSNGEHMDNATSAAMGACVELIGLAVDQLNETMTS----------SLKNFDDLRTWLSSVGTYQETCMDALVEANKP---SLTTFGE--NHLKNSTEMTSNALAIIT-WLGKIADTVKFRRRRLLETGNAKVVVADLPMMEG---RRLLESGDLKKKATIVVAKDGSGKYRTIGEALAEVEEKNEKPTIIYVKKGVYLENVRVEKTKWNVVMVGDGQSKTIVSAGLNFIDGTPTFETATFAVFGKGFMARDMGFINTAGPAKHQAVALMVSADLSVFYKCTMDAFQDTMYAHAQRQFYRDCVILGTVDFIFGNAAVVFQKCEILPRRPMKGQQNTITAQGRKDPNQNTGISIHNCTIKPLDNLTDIQTFLGRPWKDFSTTVIMKSFMDKFINPKGWLPW-TGDTAPDTIFYAEYLNSGPGASTKNRVKWQGLKTSLTKKEANKFTVKPFIDGNNWLPATKVPF 560          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME24_ARATH (Putative pectinesterase/pectinesterase inhibitor 24 OS=Arabidopsis thaliana GN=PME24 PE=3 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 3.476e-139
Identity = 261/584 (44.69%), Postives = 373/584 (63.87%), Query Frame = 1
Query:   85 YGKVDEAEERAF--KRKTRRRXXXXXXXXXXXXXXXXXXXXGTLIHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELS-GLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQES--KPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLT-ANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            YGKVDE E      +RKTR+ + I+ +S+++L  ++IGAV GT+ HK++  + +T +  + + + S+KAVC+VT +   CF ++ S  ++++ +PE LF+ ++K+ I E+S  ++ +   L  E NN      ++ C  + D  +D LN++ TS   GD   +     +DDL+TWLS+  T Q TC++ L         +   F E  + ++NS+E  SN+LAI   +  +  +F++   RRLL        +F A      RRLLQ +  +   +++VAKDGSG +RTI  A+Q V +K++ R +IYVK+G Y ENV ++K  WNV++ GDG++K+I+SG  N +DGT TF TATF V G+GF+A+D+ F NTAG +KHQAVA+   +D + FY C  +AYQDTLY H+ RQFYREC I+GT+DFIFGN+A V Q+C I PR+P+  Q NTITAQG+ DPN NTGISI +C I+P G+LT   T+LGRPWK FSTTVIM S +  F++  GW  W T    P TI Y EY+NTGPG++   RVKW G R  LS  +A +FTV  FI G  WLPA  V +   L
Sbjct:    5 YGKVDEREHVRLEARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSPETVETNNNGD-SISVSVKAVCDVTLHKEKCFETLGSAPNASSLNPEELFRYAVKITIAEVSKAINAFSSSLGDEKNNI----TMNACAELLDLTIDNLNNTLTSSSNGD---VTVPELVDDLRTWLSSAGTYQRTCVETLAP-------DMRPFGE--SHLKNSTELTSNALAIITWLGKIADSFKL--RRRLLT-TADVEVDFHA-----GRRLLQSTDLRKVADIVVAKDGSGKYRTIKRALQDVPEKSEKRTIIYVKKGVYFENVKVEKKMWNVIVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLTAFYRCTMNAYQDTLYVHAQRQFYRECTIIGTVDFIFGNSASVLQSCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDVMTFLGRPWKNFSTTVIMDSYLHGFIDRKGWLPW-TGDSAPDTIFYGEYKNTGPGASTKNRVKWKGLR-FLSTKEANRFTVKPFIDGGRWLPATKVPFRSGL 561          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME21_ARATH (Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 2.394e-127
Identity = 228/526 (43.35%), Postives = 316/526 (60.08%), Query Frame = 1
Query:  274 SLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPI--HRRLLGFQKAAPSEFPAWVSPTERRLLQE----SKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNL-----TANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            ++K VC  T Y              N TDP  L K +  V + +++  ++  + +     +++ + ALD C  + D ALD L++S    E+G  E  L D  + +L+ WLS  I+ +ETCL+  +   T  N   T+ + LK A+    E   N LAI +++   +   +IP    RRLL         FP+WV    R+LLQ     S   P+++VA+DGSG ++TINEA+Q V KK  + FV+++K G Y E V ++K   +++  GDG  KTIISG++N+ DG  T+ TAT  + G  FIAK+I FENTAGA KHQAVA+R  SD S+F++C FD YQDTLY HS+RQF+R+C I GTIDF+FG+AA VFQNC +  R+PLPNQ   ITA G+KDP ++TG   Q CTI    +      T+  YLGRPWKE+S T+IM + I  F+ P GW+ W+ +     T+ Y+E QNTGPGS +  RV WAG + TLSE D  KFT A +IQG+DW+P   V Y   L
Sbjct:   57 AVKDVCAPTDY-RKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKELMDYALDELSNSFE--ELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQ--GTQGNAGETMKKALKTAI----ELTHNGLAIISEMSNFVGQMQIPGLNSRRLLA------EGFPSWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFG-LKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQGDDWIPGKGVPYTTGL 565          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME34_ARATH (Probable pectinesterase/pectinesterase inhibitor 34 OS=Arabidopsis thaliana GN=PME34 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 4.253e-121
Identity = 229/544 (42.10%), Postives = 318/544 (58.46%), Query Frame = 1
Query:  217 KRNNSSPDTASPTELTPAASLKAVCEVTQYPXXXXXXXXXX-XXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIH-RRLLGFQKAAPSEFPAWVSPTERRLLQE--SKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVEN-VNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTA-----NTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            K N S P  A      P+ ++   CE+T++P  C  S+     S  A+  + L  +++ + +   S        L       + + A D C  + DD++D L+ + +S+         S +K  D+ TWLS  +T+ +TC +  + ++     +  + + + AA+QN SE  SN LAI +          +PI  RRLLG ++    +FP W+ P ER +L+   S+   ++IV+KDG+G  +TI+EA++   + +  R +IYVK G+Y EN + + + + N+M  GDGK KT+ISG ++  D   TF TA+F   G GFIA+DI FEN AG AKHQAVA+R G+D +V Y C    YQDTLY HSNRQF+RECDI GT+DFIFGNAAVV QNC+I  R+P+  Q NTITAQ +KDPNQNTGISI    +    +L A      TYLGRPWK FS TV M S IG  ++  GW EW T      T+ Y EY N+GPGS + QRV W GYR   S A+A +FTVA FI G  WLP+  V++   L
Sbjct:   71 KLNQSVPGLAR----KPSQAISKACELTRFPELCVDSLMDFPGSLAASSSKDLIHVTVNMTLHHFSHALYSSASLSFVDMPPRARSAYDSCVELLDDSVDALSRALSSVVS-------SSAKPQDVTTWLSAALTNHDTCTEGFDGVD-----DGGVKDHMTAALQNLSELVSNCLAIFSASHDGDDFAGVPIQNRRLLGVEER-EEKFPRWMRPKEREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQNSTRRIIIYVKAGRYEENNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQNCSIYARKPMDFQKNTITAQNRKDPNQNTGISIHASRVLAASDLQATNGSTQTYLGRPWKLFSRTVYMMSYIGGHVHTRGWLEWNTTF-ALDTLYYGEYLNSGPGSGLGQRVSWPGYRVINSTAEANRFTVAEFIYGSSWLPSTGVSFLAGL 596          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME3_CITSI (Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.320e-119
Identity = 228/545 (41.83%), Postives = 310/545 (56.88%), Query Frame = 1
Query:  211 IHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXX--XXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQ-VKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGL-LTNFRIPIHRRLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNL-----TANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            ++ R NS  +   P      A LK+ C  T+YP       +    AS   T  + + ++SL +    +       +KL   TN T+  K AL  C    D+ LD L+ +   LE    +  LS    DDLKT +S  +T+Q TCLD     +  K+      + L     +  +  SN+LA+   +    +   R   +R+L+  + +    +PAW+S  +RRLLQ S  TPNV+VA DGSG+F+T+  +V    +    R++I +K G Y ENV + K   N+M  GDG+T+TII+GSRN VDG+ TF +AT  V G GF+A+DI F+NTAG +KHQAVA+R G+D S FY+C   AYQDTLY HSNRQF+  C I GT+DFIFGNAA V QNC+I  R+P   Q N +TAQG+ DPNQNTGI IQK  I    +L     +  TYLGRPWKE+S TVIMQS+I   ++P GW EW  N    +T+ Y E+QN G G+    RVKW G+R   S  +A  FT  +FI G  WL +    +   L
Sbjct:   51 VNSRKNSGDNGNEPHH----AILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQ-HADDLKTLMSAAMTNQGTCLDGFSHDDANKHVR----DALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIE-ETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTVAASVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDVIHPAGWHEWDGNF-ALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL 584          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME28_ARATH (Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 2.568e-119
Identity = 221/533 (41.46%), Postives = 316/533 (59.29%), Query Frame = 1
Query:  238 DTASPTELTPAA-SLKAVCEVTQYPXXXXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQVKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPI--HRRLLGFQKAAPSEFPAWVSPTERRLLQE--SKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNLTA-----NTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAY 1806
            D A   E+T +  ++K VC  T Y            + + +DP  L K +    + ++S +++  + +     + + K ALD C  + D A+  L+ S    E+G  E    D  +  L+ WLS  I+ ++TCLD  +   T  N   T+ + LK A+Q       N LA+  ++   L   +IP    RRLL        EFP+W+    RRLL    S+  P+++VA+DGSG ++TINEA+  V KK  + FV+++KEG Y E V +++   +++  GDG  KT+ISGS+++ DG  T+ TAT  + G  FIAK+I FENTAGA KHQAVA+R  +D S+FY+C FD YQDTLYAHS+RQFYR+C I GTIDF+FG+AA VFQNC +  R+PL NQ   ITA G+KDP ++TG  +Q CTI    +  A      TYLGRPWKE+S T+IM + I  F+ P GW+ W+      +T+ Y+E QNTGPG+ + +RV W G +  LS+ +  KFT A +IQG+ W+P   V Y
Sbjct:   43 DNAGDEEITTSVKAIKDVCAPTDY-KETCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMDYAIGELSKSFE--ELGKFEFHKVDEALVKLRIWLSATISHEQTCLDGFQ--GTQGNAGETIKKALKTAVQ----LTHNGLAMVTEMSNYLGQMQIPEMNSRRLLS------QEFPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIAFENTAGAIKHQAVAIRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWLGEFG-LNTLFYSEVQNTGPGAAITKRVTWPGIKK-LSDEEILKFTPAQYIQGDAWIPGKGVPY 558          
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Match: PME1_CITSI (Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 8.519e-119
Identity = 231/548 (42.15%), Postives = 311/548 (56.75%), Query Frame = 1
Query:  211 IHKRNNSSPDTASPTELTPAASLKAVCEVTQYPXX--XXXXXXXXXXXNATDPEILFKLSLKVVIDELSGLSQYPKKLQAETNNTQ-VKHALDVCGTVFDDALDRLNDSATSLEVGDGESLLSDSKIDDLKTWLSTVITDQETCLDALEELNTTKNFNATLFEELKAAMQNSSEYASNSLAIAAKILGLLTNFRIPIHR----RLLGFQKAAPSEFPAWVSPTERRLLQESKPTPNVIVAKDGSGHFRTINEAVQLVGKKNQSRFVIYVKEGKYVENVNLDKHRWNVMIYGDGKTKTIISGSRNXXXXXXXXXXXXXXXXXRGFIAKDIKFENTAGAAKHQAVAMRSGSDRSVFYSCAFDAYQDTLYAHSNRQFYRECDILGTIDFIFGNAAVVFQNCNIQPRQPLPNQFNTITAQGKKDPNQNTGISIQKCTITPFGNL-----TANTYLGRPWKEFSTTVIMQSNIGAFLNPVGWREWVTNVDPPSTILYAEYQNTGPGSTVDQRVKWAGYRSTLSEADAGKFTVANFIQGEDWLPAATVAYEPAL 1818
            ++ R NS  +   P      A LK+ C  T+YP       +    AS   T  + + ++SL +    +       +KL   TN T+  K AL  C    D+ LD L+ +   LE    +  LS    DDLKT +S  +T+Q TCLD     +  K+      + L     +  +  SN+LA+       +T+  + I R    R L  + +    +PAW+SP +RRLLQ S  TPN +VA DGSG+F+T+  AV    +    R++I +K G Y ENV + K   N+M  GDG+T+TII+GSRN VDG+ TF +AT  V G GF+A+DI F+NTAG +KHQAVA+R G+D S FY+C   AYQDTLY HSNRQF+  C I GT+DFIFGNAA V QNC+I  R+P   Q N +TAQG+ DPNQNTGI IQK  I    +L     +  TYLGRPWKE+S TVIMQS+I   ++P GW EW  N    +T+ Y E+QN+G G+    RVKW G+R   S  +A  FT  +FI G  WL +    +   L
Sbjct:   51 VNSRKNSGDNGNEPHH----AILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQ-HADDLKTLMSAAMTNQGTCLDGFSHDDANKHVR----DALSDGQVHVEKMCSNALAMIKN----MTDTDMMIMRTSNNRKLTEETSTVDGWPAWLSPGDRRLLQSSSVTPNAVVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATAAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNF-ALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL 584          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0N7H7_GOSAR0.000e+0100.00Pectinesterase OS=Gossypium arboreum GN=F383_15550... [more]
A0A0D2QGG4_GOSRA0.000e+097.44Pectinesterase OS=Gossypium raimondii GN=B456_009G... [more]
A0A061GCS9_THECC0.000e+082.79Pectinesterase OS=Theobroma cacao GN=TCM_029250 PE... [more]
A0A0D2VBM0_GOSRA0.000e+081.26Pectinesterase OS=Gossypium raimondii GN=B456_010G... [more]
A0A0B0PU67_GOSAR0.000e+081.26Pectinesterase OS=Gossypium arboreum GN=F383_12686... [more]
B9T3X6_RICCO0.000e+071.19Pectinesterase OS=Ricinus communis GN=RCOM_0417590... [more]
A0A067L073_JATCU0.000e+071.14Pectinesterase OS=Jatropha curcas GN=JCGZ_24627 PE... [more]
B9GXZ7_POPTR0.000e+070.07Pectinesterase OS=Populus trichocarpa GN=POPTR_000... [more]
F6HXK9_VITVI0.000e+069.15Pectinesterase OS=Vitis vinifera GN=VIT_09s0002g00... [more]
A0A067ES96_CITSI0.000e+068.47Pectinesterase OS=Citrus sinensis GN=CISIN_1g00783... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010388 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
PME3_PHAVU0.000e+065.04Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=... [more]
PME1_ARATH0.000e+061.60Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 P... [more]
PME26_ARATH2.474e-5955.64Putative pectinesterase/pectinesterase inhibitor 2... [more]
PME46_ARATH1.595e-14648.21Probable pectinesterase/pectinesterase inhibitor 4... [more]
PME24_ARATH3.476e-13944.69Putative pectinesterase/pectinesterase inhibitor 2... [more]
PME21_ARATH2.394e-12743.35Probable pectinesterase/pectinesterase inhibitor 2... [more]
PME34_ARATH4.253e-12142.10Probable pectinesterase/pectinesterase inhibitor 3... [more]
PME3_CITSI1.320e-11941.83Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1[more]
PME28_ARATH2.568e-11941.46Putative pectinesterase/pectinesterase inhibitor 2... [more]
PME1_CITSI8.519e-11942.15Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006501Pectinesterase inhibitor domainSMARTSM00856PMEI_2coord: 69..230
e-value: 1.5E-32
score: 124.1
IPR006501Pectinesterase inhibitor domainTIGRFAMTIGR01614TIGR01614coord: 62..232
e-value: 2.9E-24
score: 83.3
IPR006501Pectinesterase inhibitor domainGENE3D1.20.140.40coord: 73..234
e-value: 5.0E-33
score: 113.7
IPR006501Pectinesterase inhibitor domainPFAMPF04043PMEIcoord: 73..230
e-value: 1.3E-25
score: 90.4
IPR006501Pectinesterase inhibitor domainSUPERFAMILY101148Plant invertase/pectin methylesterase inhibitorcoord: 74..234
IPR012334Pectin lyase foldGENE3D2.160.20.10coord: 275..585
e-value: 1.4E-116
score: 388.6
IPR000070Pectinesterase, catalyticPFAMPF01095Pectinesterasecoord: 280..573
e-value: 9.8E-138
score: 457.7
NoneNo IPR availablePANTHERPTHR31707FAMILY NOT NAMEDcoord: 26..587
NoneNo IPR availablePANTHERPTHR31707:SF42PECTINESTERASE 1-RELATEDcoord: 26..587
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 29..52
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..28
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 53..587
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
IPR018040Pectinesterase, Tyr active sitePROSITEPS00800PECTINESTERASE_1coord: 305..324
IPR033131Pectinesterase, Asp active sitePROSITEPS00503PECTINESTERASE_2coord: 424..433
IPR011050Pectin lyase fold/virulence factorSUPERFAMILY51126Pectin lyase-likecoord: 277..583

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010388 ID=g.arboreum_cottongen_reftransV1_0010388|Name=g.arboreum_cottongen_reftransV1_0010388|organism=Gossypium arboreum|type=contig|length=1961bp
TAATATTTTAACAAAGAAGCATCGAAGAGAGGTCCTATCTTTTCATCTCG
TTGAGCAATGGATTCAATCAAGTCTTTCAAGGGCTATGGCAAAGTAGACG
AGGCTGAAGAACGAGCTTTCAAGCGAAAGACACGAAGGCGTCTCATTATC
CTCGTCATCTCCATTATCGTGCTGTTAGCTGTTATCATTGGCGCAGTTGC
GGGGACTTTGATACACAAGAGAAACAACTCGTCTCCCGATACTGCATCCC
CAACCGAGTTAACTCCAGCAGCTTCATTGAAGGCGGTTTGCGAAGTGACT
CAGTACCCATCTTCCTGCTTCTCCAGCATATCATCTGTCGCATCGTCGAA
CGCAACTGACCCAGAGATCCTCTTCAAGCTGTCTTTGAAAGTAGTTATCG
ACGAGCTCTCTGGGTTGTCACAGTATCCCAAGAAGTTACAAGCTGAAACC
AATAACACCCAAGTGAAACACGCTCTAGATGTATGTGGAACCGTGTTTGA
TGACGCGTTGGATCGACTGAATGACTCGGCAACTTCCCTCGAAGTTGGGG
ACGGAGAGAGTTTGTTGTCGGATTCCAAGATCGATGACTTGAAGACATGG
TTAAGCACAGTCATAACCGATCAAGAAACATGTTTAGACGCCCTGGAGGA
ACTGAACACCACAAAGAACTTCAACGCCACACTGTTCGAAGAACTGAAAG
CCGCCATGCAGAACTCAAGTGAGTATGCCAGCAACAGTTTGGCCATCGCT
GCTAAAATCTTGGGTTTGTTGACCAATTTCCGTATCCCGATTCACCGGAG
GTTGCTTGGGTTCCAAAAAGCTGCACCTTCAGAGTTCCCAGCTTGGGTTA
GTCCCACTGAAAGGAGACTGTTGCAGGAGTCCAAGCCTACCCCAAATGTA
ATTGTGGCTAAAGACGGTTCCGGCCATTTCAGGACCATTAACGAGGCGGT
GCAATTGGTGGGAAAGAAGAACCAATCGAGATTCGTGATCTATGTGAAGG
AAGGCAAGTATGTTGAGAATGTGAATCTGGATAAACACAGGTGGAATGTC
ATGATTTACGGTGATGGCAAAACTAAGACTATAATTTCCGGCAGCCGCAA
CTTTGTTGATGGAACTGCCACCTTTGATACAGCAACTTTCACTGTGGCAG
GAAGGGGATTCATTGCAAAGGACATAAAGTTCGAAAACACAGCAGGTGCA
GCAAAGCACCAAGCAGTGGCTATGCGGTCCGGTTCTGACCGCTCGGTATT
CTACAGCTGTGCATTCGATGCCTACCAGGACACTCTCTATGCTCATTCCA
ATCGTCAGTTTTACAGAGAATGTGACATTTTGGGTACAATTGACTTCATT
TTTGGGAATGCAGCTGTTGTCTTCCAAAACTGCAACATCCAGCCCAGGCA
GCCTTTGCCTAACCAGTTCAACACCATCACAGCTCAAGGCAAAAAAGACC
CTAACCAAAATACTGGCATCTCAATTCAGAAGTGTACAATAACTCCATTT
GGCAACCTTACTGCCAATACTTACCTCGGCAGGCCCTGGAAAGAATTCTC
CACCACCGTTATTATGCAGTCCAACATTGGGGCGTTCTTGAACCCTGTGG
GCTGGAGAGAATGGGTCACTAATGTTGATCCACCCAGCACAATTTTGTAT
GCAGAATATCAAAACACTGGACCTGGATCAACCGTGGATCAAAGGGTAAA
ATGGGCTGGTTATAGGTCCACTCTCTCAGAAGCTGATGCTGGAAAGTTCA
CAGTGGCTAACTTTATACAAGGTGAAGATTGGCTGCCTGCTGCCACTGTA
GCGTATGAACCAGCTTTATGATTTTCATAATAGATTCAAGGGTAGGGTTG
TGAAAAGGTCGAAGATCAAATATTAAGATGGTGTTTTTATTTACCCTTTT
TTTGACATTAAAATTGCTCTGTAGACCTATATATTATATGTTTAACTCAA
ATGACACAAAG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR006501Pectinesterase_inhib_dom
IPR012334Pectin_lyas_fold
IPR000070Pectinesterase_cat
IPR018040Pectinesterase_Tyr_AS
IPR033131Pectinesterase_Asp_AS
IPR011050Pectin_lyase_fold/virulence
Vocabulary: Molecular Function
TermDefinition
GO:0004857enzyme inhibitor activity
GO:0030599pectinesterase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005618cell wall
Vocabulary: Biological Process
TermDefinition
GO:0042545cell wall modification