g.arboreum_cottongen_reftransV1_0018080, g.arboreum_cottongen_reftransV1_0018080 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0018080
Unique Nameg.arboreum_cottongen_reftransV1_0018080
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length569
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0018080:1..569 .
Chr1:2444765..2445569 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A0B0NVS2_GOSAR (Brefeldin A-inhibited guanine nucleotide-exchange 2 OS=Gossypium arboreum GN=F383_00117 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.477e-123
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP
Sbjct:  819 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 1007          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A0D2PTI8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G018700 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.018e-123
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKSAVDAKSESE+IIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP
Sbjct:  807 LNLALPKQKSAVDAKSESEAIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 995          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A0D2PKJ0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G018700 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.789e-123
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKSAVDAKSESE+IIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP
Sbjct:  807 LNLALPKQKSAVDAKSESEAIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 995          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A0D2QJD9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G018700 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 3.076e-123
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKSAVDAKSESE+IIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP
Sbjct:  807 LNLALPKQKSAVDAKSESEAIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 995          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A0D2N4G4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G018700 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 4.675e-123
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKSAVDAKSESE+IIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP
Sbjct:  807 LNLALPKQKSAVDAKSESEAIIKQTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 995          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A067G2C5_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0002573mg PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 2.590e-113
Identity = 164/190 (86.32%), Postives = 176/190 (92.63%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPKQKS+ D KSESE+I+KQTQAI RNQG KR VFYT+  IELV+PMVEAVGW LLA FSVTMEEGEN+PRVALCMEGFKAGIHIT VLGMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALRTLL LCD+EPDSLQDTWNAVLECVSRLEFI +TP I+A+VM GSNQIS+DAVVQSLKELAGKP
Sbjct:   99 LNLALPKQKSSTDTKSESEAIVKQTQAIFRNQGVKRGVFYTSNRIELVRPMVEAVGWPLLAAFSVTMEEGENKPRVALCMEGFKAGIHITQVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLALCDTEPDSLQDTWNAVLECVSRLEFIMSTPAISATVMLGSNQISKDAVVQSLKELAGKP 288          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A061GLV9_THECC (HOPM interactor 7 isoform 3 (Fragment) OS=Theobroma cacao GN=TCM_037433 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 5.296e-112
Identity = 173/190 (91.05%), Postives = 181/190 (95.26%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPK KSA DAKSESE+IIKQTQAIIRNQ AKR VFY AQEIELV+PMVEAVGW LLATFSVTMEEGEN+PRV LCMEGF+AGIHITYVLGMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALRTLLGLCD EPDSLQDTWNAVLECVSRLEFIT+TP IAA+VMHGSNQIS+DAVVQSLKELAGKP
Sbjct:  805 LNLALPKTKSATDAKSESEAIIKQTQAIIRNQEAKRGVFYIAQEIELVRPMVEAVGWPLLATFSVTMEEGENKPRVVLCMEGFRAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLGLCDLEPDSLQDTWNAVLECVSRLEFITSTPAIAATVMHGSNQISKDAVVQSLKELAGKP 994          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: A0A061GKQ1_THECC (HOPM interactor 7 isoform 1 OS=Theobroma cacao GN=TCM_037433 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 2.278e-111
Identity = 173/190 (91.05%), Postives = 181/190 (95.26%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPK KSA DAKSESE+IIKQTQAIIRNQ AKR VFY AQEIELV+PMVEAVGW LLATFSVTMEEGEN+PRV LCMEGF+AGIHITYVLGMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALRTLLGLCD EPDSLQDTWNAVLECVSRLEFIT+TP IAA+VMHGSNQIS+DAVVQSLKELAGKP
Sbjct:  805 LNLALPKTKSATDAKSESEAIIKQTQAIIRNQEAKRGVFYIAQEIELVRPMVEAVGWPLLATFSVTMEEGENKPRVVLCMEGFRAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLGLCDLEPDSLQDTWNAVLECVSRLEFITSTPAIAATVMHGSNQISKDAVVQSLKELAGKP 994          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: W9SKB4_9ROSA (Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Morus notabilis GN=L484_019576 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.122e-105
Identity = 162/190 (85.26%), Postives = 178/190 (93.68%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPK++S  D K+ESE+IIKQTQ I RNQG KR VFYT+Q+IELV+PMVEAVGW LLATFSVTMEEG+N+ RVALCMEGF+AGIHIT+VLGMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALRTLL LCDSE DSLQDTWNA+LECVSRLEFIT+TP IAA+VMHGSNQISRDAV+QSLKELAGKP
Sbjct:  794 LNLALPKRQSTTDTKAESEAIIKQTQTIFRNQGTKRGVFYTSQQIELVRPMVEAVGWPLLATFSVTMEEGDNKARVALCMEGFRAGIHITHVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLALCDSETDSLQDTWNAILECVSRLEFITSTPAIAATVMHGSNQISRDAVLQSLKELAGKP 983          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Match: F6HGY7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0016g00170 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.491e-105
Identity = 162/190 (85.26%), Postives = 180/190 (94.74%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNLALPK+KS+VD KSESE+IIKQTQAI RNQGAKR VFYT+Q+IELV+PMVEAVGW LLATFSVTMEEG+N+PRV LCMEGF+AGIHIT+V+GMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALRTLL LCDSE +SLQDTWNAVLECVSRLEFIT+TP IAA+VM  SNQISRDA++QSL+ELAGKP
Sbjct:  806 LNLALPKRKSSVDTKSESEAIIKQTQAIFRNQGAKRGVFYTSQQIELVRPMVEAVGWPLLATFSVTMEEGDNKPRVLLCMEGFRAGIHITHVIGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLALCDSETNSLQDTWNAVLECVSRLEFITSTPAIAATVMQASNQISRDAILQSLRELAGKP 995          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG5_ARATH (Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana GN=BIG5 PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 1.091e-100
Identity = 149/190 (78.42%), Postives = 170/190 (89.47%), Query Frame = -2
Query:    2 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR-VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFITTTPVIAASVMHGSNQISRDAVVQSLKELAGKP 568
            LNL LPK+ SA DAKSE+E I+++TQ I R  G KR VF+T +++++++PMVEAVGW LLA FSVTME G+N+PR+ LCMEGFKAGIHI YVLGMDTMRYAFLTSLVRFTFLHAPK+MRSKNVEALR LLGLCDSEPD+LQDTWNAVLECVSRLEFI +TP IAA+VMHGSNQISRD VVQSLKELAG+P
Sbjct:  789 LNLGLPKRISAADAKSETEDIVRKTQEIFRKHGVKRGVFHTVEQVDIIRPMVEAVGWPLLAAFSVTMEVGDNKPRILLCMEGFKAGIHIAYVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRILLGLCDSEPDTLQDTWNAVLECVSRLEFIISTPGIAATVMHGSNQISRDGVVQSLKELAGRP 978          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG3_ARATH (Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana GN=BIG3 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.488e-29
Identity = 56/158 (35.44%), Postives = 99/158 (62.66%), Query Frame = -2
Query:  101 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR--VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFI 568
            LN+ +P++   ++ ++ S+ +I+  Q   + +  K   V+Y A ++ +++ MVE     +LA FSV +++ ++     LC+EGF   IH+T V+ + T R AF+TSL +FT LH+P D++ KN+EA++ ++ L + E + LQD W  +L CVSR E +
Sbjct:  817 LNIVVPRRGDDMNMET-SDDLIRHMQERFKEKARKSESVYYAASDVIILRFMVEVCWAPMLAAFSVPLDQSDDAVITTLCLEGFHHAIHVTSVMSLKTHRDAFVTSLAKFTSLHSPADIKQKNIEAIKAIVKLAEEEGNYLQDAWEHILTCVSRFEHL 973          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG2_ARATH (Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.163e-28
Identity = 57/156 (36.54%), Postives = 96/156 (61.54%), Query Frame = -2
Query:  107 LNLALPKQKSAVDAKSESESIIKQTQAIIRNQGAKR--VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLE 568
            LN+ + KQ     A++ S+ ++K  Q   + +  K    +Y A ++ +++ M+EA    +LA FSV +++ ++   + +C+EGF   IH T ++ M T R AF+TSL +FT LH+P D++ +N+EA++ +L L D E + LQD W  +L CVSR E
Sbjct:  826 LNIVIRKQWGDSYAET-SDDLMKHMQEQFKEKARKSESTYYAATDVVILRFMIEACWAPMLAAFSVPLDQSDDLIVINICLEGFHHAIHATSLMSMKTHRDAFVTSLAKFTSLHSPADIKQRNIEAIKAILRLADEEGNYLQDAWEHILTCVSRFE 980          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG1_ARATH (Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana GN=BIG1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.454e-25
Identity = 48/138 (34.78%), Postives = 85/138 (61.59%), Query Frame = -2
Query:  101 IIKQTQAIIRNQGAKR--VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFI 508
            +IK  Q   R++  K    ++   ++ +++ MVE     +LA FSVT+++ ++R     C+ GF+  +H+T V+GM T R AF+TS+ +FT LH   DM+ KNV+A++ ++ +   + + LQD W  +L C+SR+E +
Sbjct:  767 LIKDIQEKFRSKSGKSESAYHVVTDVAILRFMVEVSWGPMLAAFSVTLDQSDDRLAAVECLRGFRYAVHVTAVMGMQTQRDAFVTSMAKFTNLHCAGDMKQKNVDAVKAIISIAIEDGNHLQDAWEHILTCLSRIEHL 904          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG4_ARATH (Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana GN=BIG4 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 8.587e-25
Identity = 45/133 (33.83%), Postives = 87/133 (65.41%), Query Frame = -2
Query:  101 QTQAIIRNQGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEFI 499
            Q Q   + + ++ V++T  +I +++ ++E     +LA FSVT+++ ++R   +LC++GF+  +H+T V+GM T R AF+TS+ +FT LH   DM+ KNV+A++ ++ +   + + L  +W  +L C+SR+E +
Sbjct:  795 QEQFQAKPEKSESVYHTVTDISILRFILEVSWGPMLAAFSVTIDQSDDRLATSLCLQGFRYAVHVTAVMGMQTQRDAFVTSMAKFTNLHCAADMKQKNVDAVKAIITIAIEDGNHLHGSWEHILTCLSRIEHL 927          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: SEC7A_SCHPO (Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec71 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.348e-19
Identity = 42/118 (35.59%), Postives = 72/118 (61.02%), Query Frame = -2
Query:  107 VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLE 460
            ++YTA+  E V PM EAV   +LA FS  ++   +   + L ++GF+  +++ +   MD  R AF+ +L +FT L+   +++  N+ AL+TLL +  +  D L+D+W  VL C+S+LE
Sbjct:  958 IYYTARHFEHVCPMFEAVWMPILAAFSEPLQLSSDPALIQLSLDGFRLAMNVIFFFSMDLPRNAFMQTLTKFTHLNNTSELKWTNMHALKTLLEISLAHGDKLRDSWKDVLLCISQLE 1075          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG2_HUMAN (Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens GN=ARFGEF2 PE=1 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 1.203e-17
Identity = 47/158 (29.75%), Postives = 91/158 (57.59%), Query Frame = -2
Query:  104 NLALPKQKSAVDAKSESESIIKQTQAIIRN-QGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPK---DMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEF 565
            N+A  KQ+  +    E E + K  +A++     AK  F +A  ++ V+PM + V   LLA +S+ ++  ++    +LC+EG +  I I  + GM   R A++ +L RF+ L A     +M+ KN++ ++TL+ +  ++ + L ++W+ +L+C+S+LE 
Sbjct:  845 NVASEKQRRLL-YNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLEL 1001          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG2_RAT (Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus GN=Arfgef2 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.489e-17
Identity = 46/158 (29.11%), Postives = 91/158 (57.59%), Query Frame = -2
Query:  104 NLALPKQKSAVDAKSESESIIKQTQAIIRN-QGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPK---DMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEF 565
            N+A  KQ+  +    E E + K  +A++     AK  F +A  ++ V+PM + V   LLA +S+ ++  ++    +LC+EG +  + I  + GM   R A++ +L RF+ L A     +M+ KN++ ++TL+ +  ++ + L ++W+ +L+C+S+LE 
Sbjct:  852 NVASEKQRRLL-YNVEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAVRIACIFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLEL 1008          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: BIG2_MOUSE (Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Mus musculus GN=Arfgef2 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.762e-17
Identity = 42/143 (29.37%), Postives = 84/143 (58.74%), Query Frame = -2
Query:  104 ESESIIKQTQAIIRN-QGAKRVFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPK---DMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLEF 520
            E E + K  +A++     AK  F +A  ++ V+PM + V   LLA +S+ ++  ++    +LC+EG +  + I  + GM   R A++ +L RF+ L A     +M+ KN++ ++TL+ +  ++ + L ++W+ +L+C+S+LE 
Sbjct:  866 EMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAVRIACIFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLEL 1008          
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Match: SEC7B_SCHPO (Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec72 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.548e-16
Identity = 37/127 (29.13%), Postives = 75/127 (59.06%), Query Frame = -2
Query:  107 RNQGAKR--VFYTAQEIELVKPMVEAVGWSLLATFSVTMEEGENRPRVALCMEGFKAGIHITYVLGMDTMRYAFLTSLVRFTFLHAPKDMRSKNVEALRTLLGLCDSEPDSLQDTWNAVLECVSRLE 481
            +  G+++  V+Y A   E + PM+EA    +LA  S  ++  +    + +C++GF+  + I  +  +D +R AF+ +L  FT LH+  +++ +N   ++TLL +  +E ++L+D+W  +L  +S+LE
Sbjct:  952 QKHGSQKTNVYYNATHFEHIGPMLEATWMPILAALSNPLQNSDYVNELNMCLDGFQLVVRIACLFDLDLIRDAFIKTLTNFTNLHSTSEIKLRNTMVIKTLLRIASTEGNNLKDSWKDILTIISQLE 1078          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NVS2_GOSAR1.477e-123100.00Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
A0A0D2PTI8_GOSRA2.018e-12399.47Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2PKJ0_GOSRA2.789e-12399.47Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2QJD9_GOSRA3.076e-12399.47Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2N4G4_GOSRA4.675e-12399.47Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A067G2C5_CITSI2.590e-11386.32Uncharacterized protein (Fragment) OS=Citrus sinen... [more]
A0A061GLV9_THECC5.296e-11291.05HOPM interactor 7 isoform 3 (Fragment) OS=Theobrom... [more]
A0A061GKQ1_THECC2.278e-11191.05HOPM interactor 7 isoform 1 OS=Theobroma cacao GN=... [more]
W9SKB4_9ROSA1.122e-10585.26Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
F6HGY7_VITVI1.491e-10585.26Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0018080 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
BIG5_ARATH1.091e-10078.42Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG3_ARATH4.488e-2935.44Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG2_ARATH5.163e-2836.54Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG1_ARATH2.454e-2534.78Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG4_ARATH8.587e-2533.83Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
SEC7A_SCHPO3.348e-1935.59Protein transport protein sec71 OS=Schizosaccharom... [more]
BIG2_HUMAN1.203e-1729.75Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG2_RAT1.489e-1729.11Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
BIG2_MOUSE2.762e-1729.37Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
SEC7B_SCHPO1.548e-1629.13Protein transport protein sec72 OS=Schizosaccharom... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10663:SF189SH3 DOMAIN-CONTAINING PROTEINcoord: 10..56
coord: 138..187
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 10..56
coord: 138..187

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0018080 ID=g.arboreum_cottongen_reftransV1_0018080|Name=g.arboreum_cottongen_reftransV1_0018080|organism=Gossypium arboreum|type=contig|length=569bp
CAGGTTTCCCAGCCAACTCTTTCAGTGACTGCACAACAGCATCCCTGGAG
ATCTGATTTGATCCATGCATGACACTTGCAGCAATAACAGGAGTTGTTGT
TATAAATTCAAGCCGAGAAACACATTCAAGAACAGCATTCCATGTGTCTT
GAAGAGAATCTGGTTCTGAGTCACATAAACCCAATAGAGTCCGCAATGCT
TCCACATTTTTACTACGCATATCCTTTGGGGCATGCAAGAAAGTAAACCT
GACTAGAGATGTTAAAAAGGCATAGCGCATTGTATCCATTCCGAGGACAT
ATGTGATATGTATCCCAGCTTTAAATCCTTCCATACAAAGAGCAACCCTC
GGCCTATTTTCACCTTCCTCCATTGTAACAGAGAAGGTAGCCAGCAATGA
CCATCCTACAGCTTCAACCATGGGTTTAACAAGTTCAATCTCTTGTGCAG
TGTAAAAAACTCTTTTTGCTCCTTGGTTTCGGATGATAGCCTGTGTCTGC
TTAATTATTGATTCACTTTCAGACTTAGCATCAACTGCTGATTTTTGTTT
AGGTAGAGCCAGATTAAGG
back to top