g.arboreum_cottongen_reftransV1_0005846, g.arboreum_cottongen_reftransV1_0005846 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0005846
Unique Nameg.arboreum_cottongen_reftransV1_0005846
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2091
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr4chromosomeg.arboreum_cottongen_reftransV1_0005846:1..2091 .
Chr4:64486991..64490876 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: A0A0B0PFF8_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_28931 PE=4 SV=1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 592/592 (100.00%), Postives = 592/592 (100.00%), Query Frame = 1
Query:  109 MASSLKEYLXXXXXXXXXXXXXXXXXXXXXXXXXSSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            MASSLKEYLKRYETKNEEEEQKKKRKKKKKTKPESSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTREDSDLSPPSRRPARAGSPEPRLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLKSKRKGGEEKPKEKELEWGKGLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM
Sbjct:    1 MASSLKEYLKRYETKNEEEEQKKKRKKKKKTKPESSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTREDSDLSPPSRRPARAGSPEPRLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLKSKRKGGEEKPKEKELEWGKGLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 592          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: A0A0D2PGJ9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G293700 PE=4 SV=1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 573/592 (96.79%), Postives = 580/592 (97.97%), Query Frame = 1
Query:  109 MASSLKEYLXXXXXXXXXXXXXXXXXXXXXXXXXSSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            MASSLKEYLKRYETKNEEEEQKKKRKKKKKTKPESSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHAN VDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTREDSDLSPP R+PARA SPEPRLKASRGG+DLSPP KRRVRN TPSPE LVNRADGTDLSPPRK RVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGA LSPPRKRRARNDTPSPKRRVKPLREGADSDMSPP+QRSRR+  QSPEPDM PPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQ KTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLKSKRKGGEEKPKEKELEWGKGLAQKREAETRLQ+LELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAE+MKESGF+VPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM
Sbjct:    1 MASSLKEYLKRYETKNEEEEQKKKRKKKKKTKPESSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANMVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTREDSDLSPPCRKPARADSPEPRLKASRGGSDLSPPRKRRVRNDTPSPEALVNRADGTDLSPPRKRRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGAGLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPRQRSRRQRAQSPEPDMPPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQPKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLKSKRKGGEEKPKEKELEWGKGLAQKREAETRLQDLELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAEKMKESGFIVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 592          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: A0A061F1U0_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_026519 PE=4 SV=1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 409/560 (73.04%), Postives = 449/560 (80.18%), Query Frame = 1
Query:  211 SSGVLVVDEDPVWQKPVNLEED-EGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRT-DGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            SSGV VVDEDPVWQKPVNLEED +GNDSPDEKPLVDEDIEVKRMK+LEQIRL RG N+IAEDGSGWVSLSPK  NT+DPNSD+SPPRRQR RNDTPSPEPGLRHSNSE E +DLSP R+PRSPGLKSDLSPPRRSR  N+T   RED+DLSPP RRP+R   PEP +KA++ G+DLSPP KRRVRN TPSPEP++N++D +DLSPPRK R RND+PSPE  +  T   TDL P RKR  R+ TPSPEP       D+SPPR+ R                         PQ                        TSE+V+DSDLSPPRK R+ESTGPASLK+Q KTGLISGS+IREEISKTKKDDWLRFKEMDPS+SGRGAEPV+RDKTKGERISKEE+L   ++ GE+KPKEKELEWGKGLAQKRE E RLQELE EK KPFAR RDDPELDNMLKDR+RWGDPMAHLVKKK    VL+DLGDAE+MKESGF++PQDIP HSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM
Sbjct:   38 SSGVFVVDEDPVWQKPVNLEEDNDGNDSPDEKPLVDEDIEVKRMKKLEQIRLTRGLNSIAEDGSGWVSLSPKRTNTLDPNSDVSPPRRQRARNDTPSPEPGLRHSNSEREIEDLSPLRQPRSPGLKSDLSPPRRSRVQNDTPSAREDADLSPPRRRPSRTDLPEPLVKAAKEGSDLSPPRKRRVRNDTPSPEPVLNQSD-SDLSPPRKRRARNDSPSPERRMKPTRKDTDLLPLRKRSRRHHTPSPEP-------DMSPPRRSR-------------------------PQ------------------------TSEVVNDSDLSPPRKHRKESTGPASLKEQPKTGLISGSEIREEISKTKKDDWLRFKEMDPSISGRGAEPVYRDKTKGERISKEEFL-KSKRKGEDKPKEKELEWGKGLAQKRETEARLQELEREKDKPFARNRDDPELDNMLKDRIRWGDPMAHLVKKKHSVPVLRDLGDAEKMKESGFIIPQDIPAHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 539          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: W9S5G4_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_023337 PE=4 SV=1)

HSP 1 Score: 527.324 bits (1357), Expect = 8.104e-176
Identity = 327/580 (56.38%), Postives = 404/580 (69.66%), Query Frame = 1
Query:  211 SSGVLVVDEDPVWQKPVNLEEDEGNDSPDE-KPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPP------RKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPE----PLVNRADGTDLSPPRKHRVRNDTPSPEPLVNR---TDGTDLSPPRKRRVRNDTPSPEPLAN--RAGADLSPPRKRRARNDTPSPKRRVKPLREG-ADSDMSPPQQRSRRRHTQ-----SPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            ++ VLVVDEDPVWQKPV LEE+  NDS DE KP V EDIEVKRM+RLE +R +RG  +I+EDGSGWV+LSPK +N  + NSD+SP R++ +RNDTPSP+ GL+ S S  E  DLSPP          SP +  D S  R+ RA  +T  +                       K  +   D SPP + R RNGTPSPE    P+    +  DL PPR+ R R DTPSP P  +R    +  DLSPPR+ R +NDTPSPE  +       DLSPPR+R+ R+ TPSP+  +K  R   A +D+SPP+   R    Q     S   D SPPR++         + DLSPPRK+++E    +  ++Q KTGLISG DIREEI +TKK D LRF++MDPS+SGRGAEPV+RDK +GERI+KEE+L   ++  EEKPKE +LEWGKGLAQKREAE RLQELELEK KPFA++RDDPELD MLK+R+RWGDPMAHLVK+KQ E VL +LGD+E+MKESGF++PQDIP HSW+ R LDAAPNRYGI+PGRHWDGVDRS+G+EK++F ++NEKRATEREAYLWSVSDM
Sbjct:   40 ATSVLVVDEDPVWQKPVVLEEENDNDSADEEKPQVYEDIEVKRMRRLELLRAKRGLKSISEDGSGWVTLSPKCSNINNSNSDLSPLRKRTSRNDTPSPKRGLKPSASG-EGSDLSPPWQRGRRHHTPSPEMDIDFSLARKQRAQIDTQSSEHGE-------------------KPRKEDMDFSPPRRGRARNGTPSPEHDGKPV---KENLDLLPPRRGRARYDTPSPSPSPDRKPIKENLDLSPPRRGRAQNDTPSPEHYSRPVNEDVDLSPPRQRQKRHHTPSPEPEMKSERPSVACNDISPPRGGRRDSPHQANLRGSLGSDHSPPRKN--------RNDDLSPPRKNKKE-VSVSDTREQRKTGLISGPDIREEIVRTKKQDLLRFQDMDPSISGRGAEPVYRDKIRGERITKEEFL-KSQRKVEEKPKEIKLEWGKGLAQKREAEARLQELELEKDKPFAQSRDDPELDKMLKERVRWGDPMAHLVKRKQSEPVLPNLGDSEKMKESGFIIPQDIPNHSWLKRGLDAAPNRYGIKPGRHWDGVDRSSGYEKELFKRMNEKRATEREAYLWSVSDM 586          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: A0A067LMB6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_11848 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 2.462e-167
Identity = 324/564 (57.45%), Postives = 381/564 (67.55%), Query Frame = 1
Query:  217 GVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPP----RKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEP----LVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            GVLVVDEDPVW KP+ LEE+E + + +EKP VDEDIEVKRMKRLEQ+R +   NAIAEDGSGWVSLSPK AN V+ +SD+SPP RQ TRNDTPSPEP  R S    +A DLSPP    ++   P  +SDLSPPR+ R  N+T      S                   K SR   D SPP + R  + +PSPEP      + +   DLSPPRK R+  D              DLSPPR++R R+ TPSPEP  N  G DLSPPRK R            K + + A  D+SP  QR               P+ S +  +   HD         ++ S+   S K + KTGLISG DI+EEISK KKDD LRF++MDP ++G+GAEP++RDK KG+RISKEE+L   ++  EEKPKEK+LEWGKGLAQKREAE RLQELELEK KPFARTRDDPELD MLK+RLRWGDPMAHLVK+K  E VL+DLGD+E+MKESGF+VPQ IP HSWI R LDAAPNRYGI+PGRHWDGVDRSNGFEKKMF ++NEKRATEREAYLWSVSDM
Sbjct:   41 GVLVVDEDPVWHKPIKLEEEENDSADEEKPQVDEDIEVKRMKRLEQLRAKWANNAIAEDGSGWVSLSPKRANFVNQDSDMSPPCRQSTRNDTPSPEPSERPSAGGKDA-DLSPPWQQQKRHYIPPPESDLSPPRKRRIQNDTPSPDPPS-------------------KPSREVADFSPPRQPRKHHYSPSPEPDTKLRYSNSPLPDLSPPRKQRIGKD-------------ADLSPPRQQRRRHHTPSPEP-QNSPGPDLSPPRKSR------------KGVDKLASLDLSP--QRL--------------PKNSSSIMNGSSHD---------KKGSSDLVSSKDRPKTGLISGRDIQEEISKLKKDDLLRFQQMDPKMTGQGAEPIYRDK-KGQRISKEEFL-KSKQKVEEKPKEKKLEWGKGLAQKREAEVRLQELELEKEKPFARTRDDPELDKMLKERLRWGDPMAHLVKRKHSEPVLQDLGDSEKMKESGFIVPQGIPNHSWIKRGLDAAPNRYGIKPGRHWDGVDRSNGFEKKMFQRVNEKRATEREAYLWSVSDM 531          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: M1C269_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400022576 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.438e-158
Identity = 339/616 (55.03%), Postives = 417/616 (67.69%), Query Frame = 1
Query:  112 ASSLKEYLXXXXXXXXXXXXXXXXXXXXXXXXXSSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRS--------PGLK------SDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLK-ASRGGTDLSPPWKRRVRNGTPSPE--PLVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQ-SHAQT-SELVHDSDLSPPRKSRRESTGPASL-----KQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXX-XXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            ++SLKEYLK+YE+   EE +KK++KKKK    +  GV+VVDEDPVWQKPV +E++E   + +E P V+EDIEVKRMKRLEQIR RR + +++EDGSGWVS+S   + + D  SD+SP R++  RND+PSP+P L   N    A DLSPPRKPR+         G K       DLSPPR+  A N+T  T              R  SPEP+LK +S    DLSPP KRRVRN TP  E  PL  R    D+SPPR+ R RNDTP  +    R+  TD+SPPR+RR RNDTPSPEP A R  ADLSPPR+R+    +               SD+S                D+SPPR+ S AQ  S     +DLSP RK + ++   A L     KQ  KTGL+SG DI+EEI +TKK+DW+RF+EMDP VSGRGAEPV+RDK  G+R+SKEE+LKSK+K  E++  ++     GKGLAQKRE E RLQELE EK KPFAR+RDDPELD MLK+R+RWGDPMAHLVKKK  + +L D G  E+MK+SGF++PQDIP HSWI R LDAAPNRYGIRPGRHWDGVDRS G+EK++F + NEK+ATE+EAYLWSVSDM
Sbjct:    8 STSLKEYLKKYESNTNEEGKKKQKKKKKVKPNDVKGVVVVDEDPVWQKPVKIEDEEDESADEELPQVNEDIEVKRMKRLEQIRARRPFGSVSEDGSGWVSVS---STSNDQISDLSPTRKRPGRNDSPSPDPQL---NPSSPAADLSPPRKPRARNDTPSPESGRKQPRTQEGDLSPPRKRSARNDTQRT------------RIRTPSPEPQLKPSSAKDADLSPPRKRRVRNDTPELEMKPLSTR--DADISPPRRQRARNDTPESDMKSLRSRDTDISPPRRRRTRNDTPSPEPKA-RPSADLSPPRRRQKYGQSL--------------SDIS----------------DVSPPRRGSRAQGDSRADQATDLSPLRKKKAQNALEARLDSSTTKQGPKTGLVSGKDIKEEIDRTKKEDWMRFQEMDPLVSGRGAEPVYRDKITGQRMSKEEFLKSKKKKEEKEKPKEIKLEWGKGLAQKREMEVRLQELESEKDKPFARSRDDPELDTMLKERVRWGDPMAHLVKKKL-DPILPDFGANEKMKDSGFIIPQDIPSHSWIKRGLDAAPNRYGIRPGRHWDGVDRSTGYEKELFKRTNEKQATEKEAYLWSVSDM 571          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: A0A068V8C4_COFCA (Coffea canephora DH200=94 genomic scaffold, scaffold_136 OS=Coffea canephora GN=GSCOC_T00019305001 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.841e-158
Identity = 310/587 (52.81%), Postives = 383/587 (65.25%), Query Frame = 1
Query:  214 SGVLVVDEDPVWQKPVNLEEDEGNDSPDE-KPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLS--PKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEP-LVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPE-----PLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGA-DSDMSPPQQRSRRRHTQSPEPDMSPPRQS-----------------HAQTSELVHDS---DLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            +GV+VVDEDPVWQKPV +EE+E NDS DE KP+VDEDIEVKRMKRLE +R RR + +I+EDGSGWVS+S  PK +N  D   DISPPRR+R   DTPSPE  L+ ++                 G   DLSPPR+ R  N+T                              G  +      R  RN +PSPEP   +RA G D SPPR+ +        +  +   D  D+SPPR+R+   DT S +       + R   DLSPPR++R R+ +PSP  R +    G  DSD+SPP+   +     SP  D+SPPR+                  H   ++    S   DLSPPRK  R+   P S KQQ KTGL++G D++EEI++ K++D LRFKEMDPS+SGRGAEPV+RDK  G+R+SK+E+L  K +  EEKPKE +LEWGKGLAQKREAE RLQELE EK KPFAR RDDPELD MLK+R+RWGDPMAHLVKK+Q E V++DLGD E+MKESGF++PQ+IP HSW+ R LDAAPNRYGI+PGRHWDGVDRSNGFEK+MF ++NEK+ATEREAYLWSVSDM
Sbjct:   38 TGVVVVDEDPVWQKPVRIEEEEENDSADEEKPVVDEDIEVKRMKRLELLRARRPFGSISEDGSGWVSISDAPKTSNFGDKVLDISPPRRRRA--DTPSPEHDLKSAS-----------------GRDVDLSPPRKRRVRNDTPSPEPMLRP------------------PGTGDAESLLERTRTTRNDSPSPEPDWRSRAAGADFSPPRQRQ--------KHYLKEKDERDISPPRRRKASYDTSSSKSGFGPSESRREVVDLSPPRRQRVRHLSPSPLTREETSSPGDPDSDLSPPRHFHQDHLHTSPVADLSPPRKGRKDRSVSSDLSARRATQHLDENDAAQASSALDLSPPRK--RKEKSPTS-KQQVKTGLVTGQDLKEEIARKKEEDMLRFKEMDPSISGRGAEPVYRDKVTGKRMSKDEFL--KSQKKEEKPKEVKLEWGKGLAQKREAEARLQELEGEKDKPFARRRDDPELDRMLKERVRWGDPMAHLVKKRQFEPVMEDLGDDEKMKESGFIIPQEIPSHSWLRRGLDAAPNRYGIKPGRHWDGVDRSNGFEKQMFKRMNEKQATEREAYLWSVSDM 574          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: V4T9X0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10033653mg PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 7.674e-157
Identity = 307/588 (52.21%), Postives = 376/588 (63.95%), Query Frame = 1
Query:  211 SSGVLVVDEDPVWQKPVNLEE-DEGNDSPDE-KPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPP--WKRRVRNGTPSPEPLVNRADG--TDLSPPRKHRVRNDTPSPEPLVNR--TDGTDLSPPRKRRVRNDTPSPEP---LANRAG--ADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTG-------------PASLKQQSK----TGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            ++GVL+VDEDPVWQKPVNLEE D+GNDS DE KP VDEDIEVKRMKRLEQ+RLRR YN IAEDGSGWVSL            D  PP  Q+                                    SD+SPPR+ R  N++     +                     ++R  TDLSPP  W+ R        +P    + G  +DLSPP K R  ND+PSPE L  +   + +DLSPPR+RR R  TPSPEP   +    G  +DLSPPRKRRARNDTP  +  +KP   G D+D+SPP+Q  +  +T SPEP++S  R+    +S     SDLSP R+++++ T              P  +++  K    TGLI+G DI EEIS  KK+D LRF+E+DPSV+G GAE V+RDK KG RISKE YLKSK K  E+  ++K       LAQK+EAE RL+ELELEK KPFARTRDDPELD ++KDR+RWGDPMAHLVK+K  E VL+DLG+ E+MKESGFV+PQDIP HSWI R LDAAPNRYGIRPGRHWDGVDRSNG+EK++F + NEK+AT+REAYLWSV+DM
Sbjct:   42 AAGVLIVDEDPVWQKPVNLEEEDDGNDSADEEKPQVDEDIEVKRMKRLEQLRLRRPYNGIAEDGSGWVSL------------DTLPPGSQKP----------------------------------DSDMSPPRKQRTRNDSPSPEPEPRPPA----------------SARDTTDLSPPQQWQNRRDTSLHDSDPKSAHSCGLNSDLSPPHKRRAGNDSPSPE-LREKPARESSDLSPPRQRRRRYHTPSPEPEQKIGKSRGLDSDLSPPRKRRARNDTPELEPGLKPA--GEDADLSPPRQPRKHHNTPSPEPEISVSRRVERGSSN--RGSDLSPRRRNKKDPTSGKPGLPVVPDLSPPRKIQKDEKGIQRTGLITGKDISEEISNRKKEDLLRFQELDPSVTGLGAEAVYRDK-KGGRISKEVYLKSKEKRKEKPEEKKLEWGKG-LAQKQEAEARLRELELEKEKPFARTRDDPELDKIMKDRIRWGDPMAHLVKRKHSEPVLQDLGENEKMKESGFVIPQDIPSHSWIKRGLDAAPNRYGIRPGRHWDGVDRSNGYEKQLFKRTNEKQATQREAYLWSVADM 560          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: V4KQT6_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10007193mg PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.632e-157
Identity = 321/573 (56.02%), Postives = 386/573 (67.36%), Query Frame = 1
Query:  211 SSGVLVVDEDPVWQKPVNLEEDEG-NDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSP-PRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEP--LVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGT----DLSPPRKRR-VRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLRE-GADSDMSPPQQRSRRRHTQSPEPDMSPPRQS--HAQTSELVHDS---DLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            + GVLVVDEDPVWQK V+ EE++  +DS +E+P+VDEDIEVKRM+RLE+I+ RR  NAIAEDGSGWV+L P   N  DPNSDISPPRR RTRND+PSPEPG R S S+    D+SPPR+      K   +P P  +R H                             K     +DL+PP KR+ RN +PSPEP   V +    DLSPPR+  V    PSPE    R+D      DLSPPR++R +R    SP     R   DLSPPR+RR  + +P P R  KP +  G++SD+SPP    RR    S + D+SP R++    ++S+ V  S   D SPPR+ RRES    + K+Q KTGLISG DI  E  K K D+ LRFK MD  ++G+ AE VFRDK  G+RI+KEEYL+SK+K   EKPKE +LEWGKGLAQKREAE R+QELELEK KPFARTRDDPELD M+K+R+RWGDPMAHLVKKKQ E  L DLGD E+MKESGFV+PQ IP HSWI R L+ A NRYGI+PGRHWDGVDRSNG E+ M  + NEK+ATEREAYLWSVSDM
Sbjct:   40 AKGVLVVDEDPVWQKQVDPEEEKNEDDSAEERPMVDEDIEVKRMRRLEEIKARRAQNAIAEDGSGWVTLPP---NREDPNSDISPPRRHRTRNDSPSPEPGHRRSVSDRVETDMSPPRR-----RKRHYTPSPEPNRKH----------------------------AKPVTSDSDLTPPRKRKARNDSPSPEPEDKVPKNLSEDLSPPRRRHVH--PPSPESSRKRSDSIELDGDLSPPRRKRDIRG---SPVLDVKRESNDLSPPRRRRYHSPSPEPGR--KPSKSFGSNSDLSPP----RRSVKGSRDSDLSPQRKTVDSRRSSDNVSRSSNFDSSPPRRPRRESPPHQTSKEQRKTGLISGKDIGSEYRKKKADEQLRFKNMDSELTGQNAEAVFRDKITGKRITKEEYLQSKQKKVVEKPKEIKLEWGKGLAQKREAEARIQELELEKEKPFARTRDDPELDQMMKERVRWGDPMAHLVKKKQHETSLVDLGDDEKMKESGFVIPQTIPKHSWITRGLEPAFNRYGIKPGRHWDGVDRSNGHERDMLKRTNEKKATEREAYLWSVSDM 565          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Match: B9N2S3_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0003s08550g PE=4 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 9.222e-157
Identity = 322/572 (56.29%), Postives = 389/572 (68.01%), Query Frame = 1
Query:  211 SSGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPR------SPG----LKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRAD----GTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            +SGVLVVDEDPVWQKPV LEE+E + + DE P VDEDIEVKRMKRLE IR RR YNAIAEDGSGWV L P HAN+ DP  D+SP  +++ RNDTPSPE   +  ++  +  DLSPPR+ +      SP     L SDLSPPR  R  N+T                    SPEPRLK SR  +DLSPP +++  + +PSP+P           +DLSPPR+ R   ++P  +PL    + TDLSPPR++R R+ TPSP+P       DLSPPRKR+               ++   S +      S +  TQS        R S AQ        D+SPPRK+R+ES+ P S K+  KTGLI+G D+REEI KTKK+  L F +MDPS+SGRG EPV+R     ERISK++YL   ++  EEKPKEK+LEWGKGLAQKRE ETRL+ELELEK KPFARTRDDPELD ML +R+RWGDPMAHLVKKK  EL L DLGD+E+MKESGF++PQDIP HSWI R LDAAPNRYGIRPGRHWDGVDRSNG+EK++  ++NEK+ATEREAYLWSVSDM
Sbjct:   40 ASGVLVVDEDPVWQKPVKLEEEENDSADDENPQVDEDIEVKRMKRLELIRARRAYNAIAEDGSGWVILPPNHANSADPYPDMSPLHKRKVRNDTPSPEHEGKPLHNGGDDADLSPPRQQQRQHHSPSPAPDTNLNSDLSPPRNRRYRNDT-------------------PSPEPRLKPSREASDLSPPRRQQKHHHSPSPKPYTKSKHTSVLNSDLSPPRRRRTDTESPKLKPL---KEDTDLSPPRQQRRRHYTPSPKP-----EPDLSPPRKRK---------------KDVGRSGLPDNSHLSLQLSTQS-----GNSRASMAQ--------DISPPRKNRKESSDPVSSKEPPKTGLITGRDMREEI-KTKKEASLLFDKMDPSISGRGVEPVYR-----ERISKDDYL-KSKQKVEEKPKEKKLEWGKGLAQKREVETRLEELELEKDKPFARTRDDPELDKMLMERVRWGDPMAHLVKKKHSELDLADLGDSEKMKESGFIIPQDIPSHSWIKRGLDAAPNRYGIRPGRHWDGVDRSNGYEKQLVKRVNEKQATEREAYLWSVSDM 549          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: BUD13_HUMAN (BUD13 homolog OS=Homo sapiens GN=BUD13 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.486e-37
Identity = 177/541 (32.72%), Postives = 250/541 (46.21%), Query Frame = 1
Query:  451 DISPPRRQRTRNDTPSPEP--GLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEP-LVNRADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTP-----------------SPE-------PLANRAGA---------------DLSPPRKRRARN--------------------DTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXX-XXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            D   P  +R R+DTP P P  G RH +      D SPPR+ R     SD SPPRR+R  +                            +     +  SP   RRVR+ +P P P    R   +D+S PR  RV N++P       RT G+  +  + RR R+D+P                 +PE       P    +GA               D+SPPRK++A++                    D  SP+ +  P  + +DSD+SPP+ R R R + S   D+SPPR+     S    DSDLSPPR+S+      A +   +KTGL+  +DI+ E  + K+ D    + M      + AE VFRDK+  +R  K E L+ +RK  ++  +++     GKGLAQ R+ +  +++   E  KP AR  DD +LD ML+++ R GDPMA+ +KK + +          R + SG   P                PNR+ I PG  WDGVDRSNGFE+K F +L  K+A E  AY WSV DM
Sbjct:  146 DTPDPSPRRARHDTPDPSPLRGARHDS------DTSPPRRIRHDS--SDTSPPRRARHDSPDPSPPR---------------------RPQHNSSGASP---RRVRHDSPDPSPPRRARHGSSDISSPR--RVHNNSPD---TSRRTLGSSDTQ-QLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDS---DLSPPRRRQRTKSS---DSDLSPPRRSQPPGKKAAHMYSGAKTGLVL-TDIQREQQELKEQDQ---ETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK---KVRPRYSGPAPP----------------PNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM 619          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: BUD13_CAEEL (BUD13 homolog OS=Caenorhabditis elegans GN=R08D7.1 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.132e-35
Identity = 144/388 (37.11%), Postives = 201/388 (51.80%), Query Frame = 1
Query:  778 PEPLVNRADGTDLSPPRKHRVRNDTPS--PEPLVNRTDGTDLSPPRKRRVRNDTP---SPEPLANRAGADLSPPR-KRRARNDTPSPKRRVKP---LREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRR--------------ESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKT---KGERISKEEYLXXXXXXXXXXXXXXXXXXXXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAY 1863
            PEPL       D SPPR  R R+D+ +  P P   R D +D SPPR  R R+D+    SP P   R  +D SPPR  R+ R ++PS + R  P    R+  DSD SPP+ RSRR      + D SPPR+  +  +    D DLSPPRKSR+              ++       +  ++GL S  D++EE  K +  +   F+EMD SVSGR A+ V+R K    KG+   +++  K +     E+ KEK   W KG+AQ  +   +L+E+    ++P AR RDD  ++  LK+ L   DPMA++++KK+ +  + D G+         V P     H   V      PNR+GI PG  WDGVDRSNGFE K+    N K A + E Y
Sbjct:   95 PEPL-----SPDNSPPRGKRQRHDSDNSPPRPSRKRND-SDNSPPRPSRNRHDSDKDNSP-PRRRRHDSDNSPPRPSRKIREESPSARNRRSPPRTRRDRHDSDNSPPRNRSRR------DSDNSPPRRRPSSPARRRKDDDLSPPRKSRKIEEPKKIKKEEPDSDTETSGRTLEGKRSGLQSARDLKEESDKLRAKNSKMFEEMDTSVSGRFADTVYRQKQTKKKGKDSEEDQAKKERETKKTEELKEKYKSWNKGVAQIEDRRAQLEEMARVAAEPMARARDDDAMNAHLKEVLHAADPMANMIQKKRRDTAI-DRGE--------LVYPS---YHGHFV------PNRFGIAPGYRWDGVDRSNGFEGKLAKTENTKTANQSEYY 451          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: BUD13_MOUSE (BUD13 homolog OS=Mus musculus GN=Bud13 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 9.020e-35
Identity = 125/339 (36.87%), Postives = 179/339 (52.80%), Query Frame = 1
Query:  889 TDLSPPRKRRVRNDTPSPEPLANR------AGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQQRSRRRHTQSPEPDMSPPRQSHAQTSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXX-XXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            +DLSPPRKR+ +    + + L ++      + +DLSPPRK++                + +DSD+SPP+ R RR   QS + D+SPPR+     S    DSDLSPPR+S R     A +   +KTGL++  D++ E  + KK D       D        E VFRDK+  +R  K E L+ +RK  ++  +++     GKGLAQ R+ +  +++   E  KP AR  DD +LD ML+++ R GDPMA+ +KK + +          + + SG   P                PNR+ I PG  WDGVDRSNGFE+K F +L  K+A E  AY WSV DM
Sbjct:  341 SDLSPPRKRQAKAHFEAKKQLDSKGVYQKASDSDLSPPRKKKNSG------------HQDSDSDLSPPRNRPRR---QSSDSDLSPPRRRQRTKSS---DSDLSPPRRSPRPGKKTAHMYSGAKTGLVT--DVQREHQELKKQDQ---DTTDLGAQFEFTETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK---KVKPRYSGPAPP----------------PNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM 637          

HSP 2 Score: 67.3958 bits (163), Expect = 2.731e-10
Identity = 126/399 (31.58%), Postives = 155/399 (38.85%), Query Frame = 1
Query:  220 VLVVDEDPVWQ-----KPVNLEEDEGNDSPDEKPLVDED-IEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVN-RADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLAN-RAGADLSPPRKRRARNDTPSPKRRVKPLREGADSDMSPPQ--------------------QRSRRRHTQSPEPDMSPPRQSHAQ----------------------TSELVHDSDLSPPRKSRRESTGPASLKQQSKTGLISGSD 1266
            + +VD+D  W      KP   EE++G D P     VDE   EVK+M+        +      EDG         H +  D   D SPPRR   R+DTP                D SPPRK R      D SPPR++R     T                      P  KA     D SPP  R+ R+ TP P P    R D  DLSPPR  RVR+DTP            DLSPPR  RVR+DTP P P    R   D SPPRK    +   SP+R       G+    SP Q                    Q  RR H +SP+ ++   + S A                        S+  HDSDLSPPRK + ++   A  +  SK      SD
Sbjct:   49 MRIVDDDVGWAAISTAKPEKEEEEDG-DLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHGEDG---------HFHHDD--QDSSPPRR--VRHDTP----------------DTSPPRKARHD--TPDPSPPRKARHDTPDT---------------------SPPRKARHDTPDPSPP--RKARHDTPDPSPPRRVRHDTPDLSPPR--RVRHDTP------------DLSPPR--RVRHDTPDPSPPRRVRHDLDASPPRKSHRNSSAVSPRR----GHHGSLGTSSPRQTHNHSPTAAQHRRTLDSSGTQHLRRAHHESPDLELHKAKSSKAAERAPSKAASQSGLGPSHPSLSTNSKYEHDSDLSPPRKRQAKAHFEAKKQLDSKGVYQKASD 372          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: BUD13_CHICK (BUD13 homolog OS=Gallus gallus GN=BUD13 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.567e-32
Identity = 181/593 (30.52%), Postives = 277/593 (46.71%), Query Frame = 1
Query:  214 SGVLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDIEVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNSDISPPRRQRTR---NDTP--SPEPGLRHSNSEIEAKDLSPPRKPRSPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVNRADGTDLSPPRKHRVRNDTP--SPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPRKRRARND---TPSPKRR-----------------VKPLREGADSDMSPPQQRSRRRHTQ-SPEPDMSPPRQSH-AQTSELVHDSDLSPPRKSRRE------STGPASLKQQSKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXX-XXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            +G+ +VD+D  W     + E E  +   + P+V E I+    +R ++++L   +       S W  L  +  ++  P+SD+S P +  TR   +D+P  SP   +RH     ++ DLSPPR+ R+    S    PR+ R H    L+                       +      DLSPP ++R  +      P   R D  DLSPPR  R R+D+P  SP P   R D  D SPPRK+R  +D+P   P   +   DLS  RK+R  +D   +PS ++R                 VK LR   DSD  PP     RR TQ + E D+SP  ++H A  S        SPP  SR        S    ++    + GL+S   +R E  + +K +    K ++     R  E +FRDK+  +R   +E L+ ++K   +  ++++    G+GLAQ R+ +  +++   E  KP AR  DD +LD ML+++ R GDPMA  ++K++ +   +        + SG   P                 NR+ I PG  WDGVDRSNGFE++ F ++  K+A +  AY WS+ DM
Sbjct:   39 AGMRIVDDDVGWSSIAAVPEKEEEEDEGDMPVVAEFID----ERPDEVKLMEEFRT----NSKWKLLGDRDEDS--PSSDVSVPAKATTRQQRHDSPDNSPPRRVRH-----DSPDLSPPRQERN---NSASLLPRKERQHGSPDLSPPR--------------------RKRHDSPDLSPPRRKRHDDSPDLSPPRRKRHDSPDLSPPR--RKRHDSPDLSP-PRRQRHDSPDPSPPRKKR--HDSPDLSPQEQQTTPDLSLQRKKRYDSDPDSSPSLRKRARSPGHKKPSRTKDASPVKKLRR--DSDSPPP-----RRGTQNASEADLSPQGKNHRALPSGKGQHGSKSPPDLSRHHYPDDKGSPKKGNMMSGVRAGLVSADVLRREQQELRKQE-RSSKHLE--EESRHTETIFRDKSGRKRDLVQERLEQQQKDEAKSERDEQYARWGRGLAQGRQQQQNVEDAIKEMQKPLARYIDDEDLDRMLREQEREGDPMAEFIRKRKAKESKEKKEKP---RYSGPAPPL----------------NRFNIWPGHRWDGVDRSNGFEQQFFARMANKKAVQELAYKWSIEDM 559          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: BUD13_RAT (BUD13 homolog OS=Rattus norvegicus GN=Bud13 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.210e-29
Identity = 194/655 (29.62%), Postives = 280/655 (42.75%), Query Frame = 1
Query:  220 VLVVDEDPVWQKPVNLEEDEGNDSPDEKPLVDEDI-----EVKRMKRLEQIRLRRGYNAIAEDGSGWVSLSPKHANTVDPNS---------DISPPRRQRTRNDTPSPEPGLRHSNSEIEAKDLSPPRKPR--SPGLKSDLSPPRRSRAHNETTLTXXXXXXXXXXXXXXXXXXXXXXLKASRGGTDLSPPWKRRVRNGTPSPEPLVN-RADGTDLSPPRKHRVRNDTPSPEPLVNRTDGTDLSPPRKRRVRNDTPSPEPLANRAGADLSPPR---------KRRARNDTPS---PKRRVKPLRE-------------------------GADSDMSPPQQRSRRRH-------------TQSPEPDMSPPRQSHAQTSELVHDSDLSPPR-KSRREST-------------------------GPASLKQQ------SKTGLISGSDIREEISKTKKDDWLRFKEMDPSVSGRGAEPVFRDKTKGERISKEEYLXXXXXXXXXXXXXXXXXX-XXXLAQKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            + +VD+D  W      + ++  +   + P+V E +     EVK+M+        +     +EDG         H +  DP+          D SPPRR R     PSP   +RH     +  D SPPR+ R  SP    D SP RR     + + TR                      +      D SPP  RRVR+ TP P P    R D  D SPPR  RVR+D+ +  P  +  + + +SP R     + T SP    N + A     R          RRAR+D+P    PK +     E                           DSD+SPP++R  + H              ++ + D+SPPR++ +++     DSDLSPPR + RR+S+                          P S K+       +KTGL+  +D++ E  + KK D       D        E VFRDK+  +R  K E L+ +RK  ++  +++     GKGLAQ R+ +  +++   E  KP AR  DD +LD ML+++ R GDPMA+ +KK + +          R + +G   P                PNR+ I PG  WDGVDRSNGFE+K F +L  K+A E  AY WSV DM
Sbjct:   49 MRIVDDDVGWAAISTDKLEKEEEEDGDLPVVAEFVDERPEEVKQMEAFRSSTKWKLLGGYSEDGHF-------HNDDQDPSPPRKARHDTPDASPPRRVRHGTPEPSPPRRVRH-----DTPDPSPPRRVRHDSP----DPSPTRRGHDSPDPSPTR----------------------RVHHDSPDPSPP--RRVRHDTPDPSPPRRVRHDTPDPSPPR--RVRHDSDASPPRRSHRNSSAVSPKRGHHGSSGTSSPRQAHNHSPAAAQHRRTLDSSGAQHHRRARHDSPDLELPKAKSSKAAERPSSKTVSQSGLGPPHPSLSMNSKYEHDSDLSPPRKRQAKAHFGAKKQLDSKGVCQKASDSDLSPPRKN-SKSGHQDSDSDLSPPRNRPRRQSSDSDLSPPRRRQRTKSSDSDLSPSRRSPRSGKKTPHMYSGAKTGLV--ADVQREHQELKKQDQ---DATDLGAQFEFTETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKN---KKVRPRYNGPAPP----------------PNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM 636          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: CWC26_SCHPO (Pre-mRNA-splicing factor cwf26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf26 PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 2.429e-19
Identity = 50/128 (39.06%), Postives = 66/128 (51.56%), Query Frame = 1
Query: 1501 LQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSVSDM 1884
            L+ELE +K+ P AR  DDPE +  LK+R RW DP A  +  K                          P  S    +  A PNR+ IRPG  WDG+ R NGFE K F + NE++A E EA++W++ DM
Sbjct:  205 LKELERQKTVPLARYEDDPEYNKELKERSRWNDPAASFLTNK--------------------------PVSSKATYQGYAPPNRFNIRPGHRWDGIIRGNGFENKWFQRQNERKAQEHEAHMWAIEDM 306          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: CWC26_EMENI (Pre-mRNA-splicing factor cwc26 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc26 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.075e-15
Identity = 51/133 (38.35%), Postives = 62/133 (46.62%), Query Frame = 1
Query: 1477 QKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSV 1875
            Q+ E E+R   LE  K  P ART DD EL+  LK + RW DP A  + K                   G       P +    +     PNRYGIRPG  WDGVDRSNGFEK+ F   N+K   +   Y W +
Sbjct:  232 QRAERESRRAALEEAKVMPLARTADDEELNEELKAQTRWNDPAAQFLTKST----------------GGGRSKTGKPLYKGAFQ-----PNRYGIRPGHRWDGVDRSNGFEKEWFAARNKKERMQALEYEWQM 343          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: CWC26_MAGO7 (Pre-mRNA-splicing factor CWC26 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC26 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.735e-14
Identity = 51/133 (38.35%), Postives = 67/133 (50.38%), Query Frame = 1
Query: 1477 QKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSV 1875
            Q  EA  R ++LE     P AR +DD E++N +K   RW DPM   + +        D  +A    ++G    +  P     V K  AAPNRYGIRPG  WDGVDR  GFE + F  LN +  T+   Y W +
Sbjct:  230 QIEEARRRREKLEDAALMPLARGKDDEEMNNAMKSEQRWNDPMMQFMSEN-------DKREAGGTAKTGGRRVKGRP-----VYKGPAAPNRYGIRPGYRWDGVDRGIGFEAERFKALNRRERTKDLEYNWQM 350          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: CWC26_ASPFU (Pre-mRNA-splicing factor cwc26 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc26 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.859e-14
Identity = 49/134 (36.57%), Postives = 66/134 (49.25%), Query Frame = 1
Query: 1477 QKREAETRLQELELEKSKPFARTRDDPELDNMLKDRLRWGDPMA-HLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSV 1875
            Q+ E E R Q+++  ++ P ART +D  L+  LK + RW DP A  L K K P + +      + + +  F                   PNRYGIRPG  WDGVDR NGFEK+ F   N+K   E   Y W +
Sbjct:  231 QRAEREARRQQIQEARAMPLARTIEDDALNEELKAQQRWNDPAAGFLTKTKGPGVSVT----GKPLYKGAF------------------QPNRYGIRPGHRWDGVDRGNGFEKEWFAARNKKGRLEALDYQWQM 342          
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Match: CWC26_NEUCR (Pre-mRNA-splicing factor cwc-26 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-26 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 9.077e-14
Identity = 45/118 (38.14%), Postives = 62/118 (52.54%), Query Frame = 1
Query: 1522 KSKPFARTRDDPELDNMLKDRLRWGDPMAHLVKKKQPELVLKDLGDAERMKESGFVVPQDIPPHSWIVRKLDAAPNRYGIRPGRHWDGVDRSNGFEKKMFTKLNEKRATEREAYLWSV 1875
            K  P AR++DD +L+  LK + RW DPMA  +  ++ ++  +  G A R            P +     K  A PNRYGI+PG  WDGVDRSNGFE + F  LN +   +   Y W +
Sbjct:  274 KLMPLARSKDDEQLNAELKQQDRWNDPMAQFLAPEEVKVKGRKKGTAGRR-----------PTY-----KGPAPPNRYGIKPGYRWDGVDRSNGFEAERFKALNRRERNKGLEYAWQM 375          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PFF8_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2PGJ9_GOSRA0.000e+096.79Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061F1U0_THECC0.000e+073.04Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
W9S5G4_9ROSA8.104e-17656.38Uncharacterized protein OS=Morus notabilis GN=L484... [more]
A0A067LMB6_JATCU2.462e-16757.45Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
M1C269_SOLTU1.438e-15855.03Uncharacterized protein OS=Solanum tuberosum GN=PG... [more]
A0A068V8C4_COFCA1.841e-15852.81Coffea canephora DH200=94 genomic scaffold, scaffo... [more]
V4T9X0_9ROSI7.674e-15752.21Uncharacterized protein OS=Citrus clementina GN=CI... [more]
V4KQT6_EUTSA8.632e-15756.02Uncharacterized protein OS=Eutrema salsugineum GN=... [more]
B9N2S3_POPTR9.222e-15756.29Uncharacterized protein OS=Populus trichocarpa GN=... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0005846 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
BUD13_HUMAN1.486e-3732.72BUD13 homolog OS=Homo sapiens GN=BUD13 PE=1 SV=1[more]
BUD13_CAEEL2.132e-3537.11BUD13 homolog OS=Caenorhabditis elegans GN=R08D7.1... [more]
BUD13_MOUSE9.020e-3536.87BUD13 homolog OS=Mus musculus GN=Bud13 PE=1 SV=1[more]
BUD13_CHICK6.567e-3230.52BUD13 homolog OS=Gallus gallus GN=BUD13 PE=2 SV=1[more]
BUD13_RAT2.210e-2929.62BUD13 homolog OS=Rattus norvegicus GN=Bud13 PE=2 S... [more]
CWC26_SCHPO2.429e-1939.06Pre-mRNA-splicing factor cwf26 OS=Schizosaccharomy... [more]
CWC26_EMENI1.075e-1538.35Pre-mRNA-splicing factor cwc26 OS=Emericella nidul... [more]
CWC26_MAGO71.735e-1438.35Pre-mRNA-splicing factor CWC26 OS=Magnaporthe oryz... [more]
CWC26_ASPFU2.859e-1436.57Pre-mRNA-splicing factor cwc26 OS=Neosartorya fumi... [more]
CWC26_NEUCR9.077e-1438.14Pre-mRNA-splicing factor cwc-26 OS=Neurospora cras... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 2..29
NoneNo IPR availablePANTHERPTHR31809FAMILY NOT NAMEDcoord: 1..191
coord: 208..592
IPR018609Bud13PFAMPF09736Bud13coord: 416..575
e-value: 4.9E-41
score: 140.4

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0005846 ID=g.arboreum_cottongen_reftransV1_0005846|Name=g.arboreum_cottongen_reftransV1_0005846|organism=Gossypium arboreum|type=contig|length=2091bp
CTTTTCTTCCCCTAATTTATCCCTCTCGTCTTCCTCCGGTTCCCGACCCA
AGTCCTCCCTTGCCTTCCAAGTTTCCGATCGAAGAAGAAATTAAATAAGG
GGCAGCCAATGGCGAGTTCTTTGAAAGAATACCTAAAAAGATACGAGACC
AAAAACGAAGAAGAGGAGCAGAAGAAGAAAAGGAAGAAAAAGAAGAAAAC
TAAACCCGAATCATCAGGTGTTCTAGTGGTGGATGAAGATCCAGTGTGGC
AGAAACCTGTTAATCTCGAAGAAGATGAGGGCAATGATTCACCTGATGAG
AAGCCACTAGTGGATGAAGATATAGAAGTAAAAAGAATGAAAAGGCTAGA
GCAGATTAGGTTGAGGAGGGGCTACAATGCCATTGCCGAAGATGGTAGTG
GTTGGGTCTCGCTTTCTCCTAAACACGCTAATACAGTGGATCCTAATTCT
GATATTTCCCCTCCTCGTAGGCAGCGGACACGAAATGACACACCTTCTCC
AGAACCTGGGTTGAGGCACTCAAACTCTGAAATAGAAGCTAAGGATTTGT
CACCTCCGAGAAAACCACGTTCCCCTGGTTTGAAATCTGATTTGTCACCG
CCAAGGAGAAGTAGGGCTCATAATGAGACAACATTAACAAGAGAAGATTC
TGATTTGTCACCTCCTAGCAGGAGGCCAGCTCGGGCTGGTTCACCAGAAC
CTCGACTTAAGGCTTCTAGAGGTGGTACTGATTTATCTCCTCCTTGGAAG
CGGAGGGTTAGGAATGGCACACCCTCACCAGAACCTTTAGTAAACAGAGC
AGATGGTACTGATTTATCTCCTCCTAGGAAACATAGGGTTCGGAATGACA
CACCTTCACCAGAACCTTTAGTAAACCGAACAGATGGTACTGATTTATCT
CCTCCAAGGAAACGGAGGGTTCGGAATGACACACCTTCACCAGAACCTTT
AGCAAACAGAGCAGGTGCTGATCTGTCACCACCTCGGAAACGAAGGGCGA
GAAATGATACACCTTCACCAAAACGGAGGGTGAAGCCTTTGAGAGAAGGT
GCTGATAGTGATATGTCACCTCCACAGCAAAGGTCAAGACGCCGACATAC
ACAATCACCTGAGCCTGATATGTCCCCACCTAGACAATCTCATGCCCAAA
CATCTGAGCTTGTTCATGATTCGGATCTCTCCCCTCCAAGGAAAAGTAGG
AGGGAATCAACTGGTCCTGCTTCTTTGAAACAGCAATCCAAAACTGGTTT
AATTTCTGGCAGTGATATTCGAGAAGAAATTTCAAAAACGAAGAAGGATG
ATTGGTTAAGGTTTAAGGAGATGGATCCATCTGTAAGCGGACGAGGTGCT
GAGCCTGTATTTCGTGATAAGACAAAAGGGGAGCGCATATCAAAAGAAGA
GTACCTTAAGTCAAAACGAAAAGGAGGAGAAGAAAAGCCCAAGGAGAAAG
AGTTGGAATGGGGCAAAGGCTTAGCGCAAAAACGTGAAGCTGAGACTAGG
TTGCAAGAATTAGAACTCGAGAAGAGTAAACCATTTGCTCGAACAAGGGA
TGACCCAGAGCTCGACAATATGTTGAAGGATCGACTAAGATGGGGTGATC
CTATGGCTCATTTGGTCAAGAAAAAACAACCTGAGCTGGTTCTTAAAGAC
CTAGGGGATGCTGAGAGAATGAAAGAGTCGGGGTTCGTAGTTCCTCAAGA
TATTCCCCCGCATAGTTGGATAGTAAGAAAACTAGATGCTGCACCAAATC
GTTATGGTATAAGACCAGGAAGACATTGGGACGGAGTCGATCGTAGTAAT
GGTTTTGAGAAGAAAATGTTCACCAAATTAAACGAGAAACGGGCAACGGA
AAGGGAGGCGTATCTCTGGTCTGTATCCGACATGTGATTCAACACTCCAC
AGCAGACTTTTTAAGTGAGAAATTAAGTATGCTGAAATTGAGAAATTATT
TGCTTCATGCTTTTGTGCCAATTTTAAATTATAACAAATCAATGGTTTTG
ATCCATGATAATTGACTCAGTGAGTCTTGACTGGTGTATTATCATTTCAA
ATCAATTTTCATCAACTTTTGGGTGTCAATTTTATAGGTTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR018609Bud13