g.arboreum_cottongen_reftransV1_0017420, g.arboreum_cottongen_reftransV1_0017420 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0017420
Unique Nameg.arboreum_cottongen_reftransV1_0017420
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2193
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr11chromosomeg.arboreum_cottongen_reftransV1_0017420:1..2193 .
Chr11:29313895..29318046 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0B0N7B5_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_33371 PE=4 SV=1)

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 564/564 (100.00%), Postives = 564/564 (100.00%), Query Frame = -1
Query:  325 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQS 2016
            MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSEDLSKDSGSSNSSRSSNRSHQSKNTVLRFFSSRSFKRSSSQNMSDQESQS
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSEDLSKDSGSSNSSRSSNRSHQSKNTVLRFFSSRSFKRSSSQNMSDQESQS 564          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0D2NLD7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G036800 PE=4 SV=1)

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 554/574 (96.52%), Postives = 561/574 (97.74%), Query Frame = -1
Query:  298 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXX-XXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEIE 2016
            MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFC PICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLA+CIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK+GQYYEIRFL LLPALIAAVLGFLVDFPMISLIA CKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGS+ SSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDL PL+LLEGLFKEC VHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKD+FFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSE    KDSGSSNSS SSNRSHQSKNTVLRFFSSRSFKRS+S +MSDQESQSVLARD EIE
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCFPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAVCIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKDGQYYEIRFLYLLPALIAAVLGFLVDFPMISLIAFCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSMASSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLKPLELLEGLFKECQVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDAFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSEDLSKKDSGSSNSSGSSNRSHQSKNTVLRFFSSRSFKRSTSHSMSDQESQSVLARDVEIE 574          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0D2RWN3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G036800 PE=4 SV=1)

HSP 1 Score: 955.666 bits (2469), Expect = 0.000e+0
Identity = 552/592 (93.24%), Postives = 559/592 (94.43%), Query Frame = -1
Query:  244 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXX-XXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEIE*CRNRMSIKNHNQFLPEM 2016
            MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFC PICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLA+CIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK+GQYYEIRFL LLPALIAAVLGFLVDFPMISLIA CKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGS+ SSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDL PL+LLEGLFKEC VHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKD+FFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSE    KDSGSSNSS SSNRSHQSKNTVLRFFSSRSFKRS+S +M                     MSIKNHNQFLPEM
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCFPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAVCIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKDGQYYEIRFLYLLPALIAAVLGFLVDFPMISLIAFCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSMASSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLKPLELLEGLFKECQVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDAFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSEDLSKKDSGSSNSSGSSNRSHQSKNTVLRFFSSRSFKRSTSHSM---------------------MSIKNHNQFLPEM 571          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0B0N313_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_33371 PE=4 SV=1)

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 511/511 (100.00%), Postives = 511/511 (100.00%), Query Frame = -1
Query:  484 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVN 2016
            MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVN
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVN 511          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0D2NLE0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G036800 PE=4 SV=1)

HSP 1 Score: 915.22 bits (2364), Expect = 0.000e+0
Identity = 513/532 (96.43%), Postives = 520/532 (97.74%), Query Frame = -1
Query:  298 MTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXX-XXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEIE 1890
            MTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLA+CIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK+GQYYEIRFL LLPALIAAVLGFLVDFPMISLIA CKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGS+ SSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDL PL+LLEGLFKEC VHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKD+FFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSE    KDSGSSNSS SSNRSHQSKNTVLRFFSSRSFKRS+S +MSDQESQSVLARD EIE
Sbjct:    1 MTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAVCIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKDGQYYEIRFLYLLPALIAAVLGFLVDFPMISLIAFCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSMASSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLKPLELLEGLFKECQVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDAFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNKLSEDLSKKDSGSSNSSGSSNRSHQSKNTVLRFFSSRSFKRSTSHSMSDQESQSVLARDVEIE 532          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0D2SRL4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G036800 PE=4 SV=1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 477/488 (97.75%), Postives = 482/488 (98.77%), Query Frame = -1
Query:  553 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKNGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARR 2016
            MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFC PICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLA+CIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK+GQYYEIRFL LLPALIAAVLGFLVDFPMISLIA CKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGS+ SSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDL PL+LLEGLFKEC VHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKD+FFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARR
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLLLGTIKGIIFCFPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAVCIFLPVVLILWVVVGIVGSILGGILYGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQKDGQYYEIRFLYLLPALIAAVLGFLVDFPMISLIAFCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSMASSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNARLDLKPLELLEGLFKECQVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDAFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKNIGSPPESERKRAELDALARR 488          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0B0MMT3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_18940 PE=4 SV=1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 445/585 (76.07%), Postives = 496/585 (84.79%), Query Frame = -1
Query:  301 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK---NGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNE------SFSKSDSFR--PPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLK--NIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEI 2016
            ME PKGFLATLWNFICFLPYF GLLLLGTIKGI+FC  ICLI+TIGNSS+ILGLLP+H Y+T YSIV TKLLGPFLK+ IC+FLPVVLILWVVVGIVGS +GG+LYGFLSP+FATFDAVG+GKTNVF+HCFYDGT S+I GSFTVV+DF DVC HSY S ME+LRQK   NG+YYEIRFL L PALI AVLGF+VDFP+ISLIALCKSPYML KGWHRLFHDL+GREGPFLETICVPFAGLAILLWPLA +GAVLGS+VSSIFLGAYA VIVYQESSFW+G+CYI+ASLSIYDEYS DVLDMPEGSC  RP+YR++  E      S S+SDS +  PPAR+DSLTN R+DL PL+LLEGLFKEC  HGEKMVSE LITSKDI++AK  KGSRV+ IGLPAYC LQ LLRSV++NR GILLSDNTEITATNRPKD+FFDWFLNPFLILKEQI++ENLS EE+DYLGKLVLLCGD ARLK   IGSPPES+RK+AELDA+ARRLQGITKSVSRYPTFRRHFE  VN LSEDL+K S     +       +   + L    S      ++ NMSDQE QS +ARD EI
Sbjct:    1 MEAPKGFLATLWNFICFLPYFFGLLLLGTIKGIVFCPLICLIITIGNSSIILGLLPFHGYWTCYSIVRTKLLGPFLKVFICVFLPVVLILWVVVGIVGSSIGGLLYGFLSPIFATFDAVGKGKTNVFVHCFYDGTLSSISGSFTVVRDFYDVCFHSYVSLMEDLRQKGPPNGKYYEIRFLYLPPALITAVLGFIVDFPVISLIALCKSPYMLFKGWHRLFHDLIGREGPFLETICVPFAGLAILLWPLATVGAVLGSMVSSIFLGAYAGVIVYQESSFWFGICYIIASLSIYDEYSNDVLDMPEGSCFARPKYRQNLKEPISNAGSLSESDSLKPHPPARMDSLTNTRIDLKPLELLEGLFKECRRHGEKMVSERLITSKDIEEAKLTKGSRVIGIGLPAYCLLQTLLRSVNSNRSGILLSDNTEITATNRPKDTFFDWFLNPFLILKEQIKSENLSEEEEDYLGKLVLLCGDPARLKISKIGSPPESDRKQAELDAIARRLQGITKSVSRYPTFRRHFENLVNILSEDLAKKSNGGTQAI------RRSKSALAMIFSNKSFDRNTSNMSDQELQSTIARDIEI 579          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0B0MHG2_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_18940 PE=4 SV=1)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 440/590 (74.58%), Postives = 493/590 (83.56%), Query Frame = -1
Query:  301 MEPPKGFLATLWNFICFLPYFXXXXXXXXX-----XXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK---NGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNE------SFSKSDSFR--PPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLK--NIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEI 2016
            ME PKGFLATLWNFICFLPYF GLLL+  +      GI+FC  ICLI+TIGNSS+ILGLLP+H Y+T YSIV TKLLGPFLK+ IC+FLPVVLILWVVVGIVGS +GG+LYGFLSP+FATFDAVG+GKTNVF+HCFYDGT S+I GSFTVV+DF DVC HSY S ME+LRQK   NG+YYEIRFL L PALI AVLGF+VDFP+ISLIALCKSPYML KGWHRLFHDL+GREGPFLETICVPFAGLAILLWPLA +GAVLGS+VSSIFLGAYA VIVYQESSFW+G+CYI+ASLSIYDEYS DVLDMPEGSC  RP+YR++  E      S S+SDS +  PPAR+DSLTN R+DL PL+LLEGLFKEC  HGEKMVSE LITSKDI++AK  KGSRV+ IGLPAYC LQ LLRSV++NR GILLSDNTEITATNRPKD+FFDWFLNPFLILKEQI++ENLS EE+DYLGKLVLLCGD ARLK   IGSPPES+RK+AELDA+ARRLQGITKSVSRYPTFRRHFE  VN LSEDL+K S     +       +   + L    S      ++ NMSDQE QS +ARD EI
Sbjct:    1 MEAPKGFLATLWNFICFLPYFFGLLLIEILHCIIHSGIVFCPLICLIITIGNSSIILGLLPFHGYWTCYSIVRTKLLGPFLKVFICVFLPVVLILWVVVGIVGSSIGGLLYGFLSPIFATFDAVGKGKTNVFVHCFYDGTLSSISGSFTVVRDFYDVCFHSYVSLMEDLRQKGPPNGKYYEIRFLYLPPALITAVLGFIVDFPVISLIALCKSPYMLFKGWHRLFHDLIGREGPFLETICVPFAGLAILLWPLATVGAVLGSMVSSIFLGAYAGVIVYQESSFWFGICYIIASLSIYDEYSNDVLDMPEGSCFARPKYRQNLKEPISNAGSLSESDSLKPHPPARMDSLTNTRIDLKPLELLEGLFKECRRHGEKMVSERLITSKDIEEAKLTKGSRVIGIGLPAYCLLQTLLRSVNSNRSGILLSDNTEITATNRPKDTFFDWFLNPFLILKEQIKSENLSEEEEDYLGKLVLLCGDPARLKISKIGSPPESDRKQAELDAIARRLQGITKSVSRYPTFRRHFENLVNILSEDLAKKSNGGTQAI------RRSKSALAMIFSNKSFDRNTSNMSDQELQSTIARDIEI 584          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A0D2VXC8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G091500 PE=4 SV=1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 445/585 (76.07%), Postives = 491/585 (83.93%), Query Frame = -1
Query:  301 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK---NGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNE------SFSKSDSFR--PPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLK--NIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEI 2016
            ME PKGFLATLWNFICFLPYF GLLLLGTIKGI+FC  ICLI+TI NSS+ILGLLP+H Y+T YSIV TKLLGPFLKL IC+FLPVVLILWVVVGIVGS +GG+LYGFLSP+FATFDAVG+GKTNVF+HCFYDGT STI GSFTVV+DF DVC HSY S ME+LRQK   NG+YYEIRFL L PALIAAVLGF+VDFP+ISLIALCKSPYML KGW RLFHDL+GREGPFLETICVPFAGLAILLWPLA +GAVLGS+VSSIFLGAYA VIVYQESSFW+GLCY++ASLSIYDEYS DVLDMPEGSC  RP+YR++  E      S S+SDS +  PPAR+DSLTN R+DL PL+LLEGLFKEC  HGEKMVSE LITSKDI++AK  KGSRV+ IGLPAYC LQ LLRSV+ NR GILLSDNTEITATNRPKD+FFDWFLNPFLILKEQI++ENLS EE+DYLGKLVLLCGD  RLK   IGSPPES+RKRAELDA+ARRLQGITKSVSRYPTFRR FE  VN LSEDL+K S             +   + L    S      ++ NMSDQE QS +ARD EI
Sbjct:    1 MEAPKGFLATLWNFICFLPYFFGLLLLGTIKGIVFCPLICLIITIVNSSIILGLLPFHGYWTCYSIVRTKLLGPFLKLFICVFLPVVLILWVVVGIVGSSIGGVLYGFLSPIFATFDAVGKGKTNVFVHCFYDGTLSTISGSFTVVRDFYDVCFHSYVSLMEDLRQKGPPNGKYYEIRFLYLPPALIAAVLGFIVDFPVISLIALCKSPYMLYKGWRRLFHDLIGREGPFLETICVPFAGLAILLWPLATVGAVLGSMVSSIFLGAYAGVIVYQESSFWFGLCYVIASLSIYDEYSNDVLDMPEGSCFARPKYRQNLKEPISNAGSLSESDSLKPHPPARMDSLTNTRIDLKPLELLEGLFKECRRHGEKMVSERLITSKDIEEAKLTKGSRVIGIGLPAYCLLQTLLRSVNNNRSGILLSDNTEITATNRPKDTFFDWFLNPFLILKEQIKSENLSEEEEDYLGKLVLLCGDPERLKISKIGSPPESDRKRAELDAIARRLQGITKSVSRYPTFRRLFENLVNILSEDLAKKSNGGTQPI------RRSKSALAMIFSNKSFNRNTSNMSDQELQSTIARDIEI 579          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Match: A0A061EJZ3_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_017046 PE=4 SV=1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 454/586 (77.47%), Postives = 509/586 (86.86%), Query Frame = -1
Query:  301 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK---NGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNE------SFSKSDSFR--PPARIDSLTNARLDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDNTEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLK--NIGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXX-SHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEI 2016
            MEPPKGFLATLWNFICFLPYFIGLL LGTIKGIIFC+PICLIMT+GNSS+ILGLL +H Y+T YS+V  KLLGP LKL IC+ LPV+LILWVVV IVGSI+GGILYGFLSP+FATFDAVGEGKTNVF HCFYDGTWSTIKGSFT V+DF DVC HS+ S+MEEL+QK   NG+YYEIRFL L  ALIAAVLGF+VD P+ISLIAL KSPYML KGW+RLFHDL+GREGPFLETICVPFAGLAILLWPLAV+GAVLGS+VSSIFLGAYA V+VYQ SSFW+GLCYIVAS+SIYDEYS DVLDMPEGSC PRP+YRR++ E      SF+ SDSF+  PPAR +SLTN R+DL PL+LLEGLFKEC  HGEKMVSEGLIT KDI+DAKS KGS VVSIGLPAYC LQALLRSV+AN+ GILLSDNTEITATNRPKD+FFDWFLNPFLILKEQI+AENLS EE+DYLGKLVLL GD  RLK  NIGSPPESERKRAELDALARRL+GITKSVSRYPT+ RHF   VN LSEDL+K +  S+   +  +   ++K+ + R FS++SFK+++S NMS QES SV+ARD EI
Sbjct:    1 MEPPKGFLATLWNFICFLPYFIGLLFLGTIKGIIFCAPICLIMTVGNSSIILGLLLFHFYWTCYSVVRAKLLGPVLKLLICVCLPVLLILWVVVAIVGSIIGGILYGFLSPIFATFDAVGEGKTNVFFHCFYDGTWSTIKGSFTFVRDFNDVCFHSFTSYMEELQQKEPPNGKYYEIRFLYLPLALIAAVLGFMVDLPVISLIALWKSPYMLFKGWNRLFHDLIGREGPFLETICVPFAGLAILLWPLAVVGAVLGSMVSSIFLGAYAGVVVYQGSSFWFGLCYIVASVSIYDEYSNDVLDMPEGSCFPRPQYRRNKKESTRSASSFTNSDSFKPHPPARANSLTNTRIDLKPLELLEGLFKECSRHGEKMVSEGLITPKDIEDAKSSKGSSVVSIGLPAYCLLQALLRSVNANKSGILLSDNTEITATNRPKDTFFDWFLNPFLILKEQIKAENLSLEEEDYLGKLVLLSGDPERLKISNIGSPPESERKRAELDALARRLRGITKSVSRYPTYWRHFANLVNTLSEDLAKKNHDSSRLSNGAQPIRRTKSALARIFSNKSFKQNASYNMSIQESGSVIARDIEI 586          
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy Swiss-Prot
Match: Y3739_ARATH (Uncharacterized membrane protein At3g27390 OS=Arabidopsis thaliana GN=At3g27390 PE=1 SV=2)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 371/590 (62.88%), Postives = 447/590 (75.76%), Query Frame = -1
Query:  301 MEPPKGFLATLWNFICFLPYFXXXXXXXXXXXXIFCSPICLIMTIGNSSVILGLLPYHCYFTYYSIVSTKLLGPFLKLAICXXXXXXXXXXXXXXXXXXXXXXXXXGFLSPMFATFDAVGEGKTNVFIHCFYDGTWSTIKGSFTVVKDFKDVCVHSYYSFMEELRQK--NGQYYEIRFLCLLPALIAAVLGFLVDFPMISLIALCKSPYMLVKGWHRLFHDLVGREGPFLETICVPFAGLAILLWPLAVIGAVLGSIVSSIFLGAYAAVIVYQESSFWYGLCYIVASLSIYDEYSTDVLDMPEGSCLPRPRYRRHRNESFSKSDSFRPPARIDSLTNAR-----------LDLNPLQLLEGLFKECHVHGEKMVSEGLITSKDIDDAKSIKGSRVVSIGLPAYCFLQALLRSVDANRLGILLSDN-TEITATNRPKDSFFDWFLNPFLILKEQIRAENLSPEEKDYLGKLVLLCGDAARLKN----IGSPPESERKRAELDALARRLQGITKSVSRYPTFRRHFEEFVNXXXXXXXXXXXXXXXXXXXXXSHQSKNTVLXXXXXXXXXXXXSQNMSDQESQSVLARDAEI 2016
            MEPP GF A+L+ F+ FLPYFIGLL LG IKGI+ C  +CL++TIGNS+VIL LLP H  +T+YSIVS K +GP LK+ +C+ LP  +ILW +VGI+GS+LGG LYGF SP+FATFDAVGEGK   F HCFYDGTWST++ SFTVV+DFKDVC HSY+S M+EL+Q   + +YYEIR L L  AL+ +VLG LVD P+ISL+A+CKSPYML KGWHRLFHDL+GREGPFLET+CVP AGLAILLWPLAV GAV+GS++SSIFLGAYA V+ YQESSF+YGLCYIVAS+SIYDEYSTD+LD+PEGSC PRP+YRR   E    S    P  R+ S+ NA            +D+ PL LL  LF EC  +GE + ++GLI SKDI++A+S KGS+V+S+GLPAY  L  +LRSV AN  G+LLSD  TEIT  NRPKD FFDWFLNPFLILKEQ++A NLS EE++YLG+LVLL GD  RLK+      SPP +ERKRAELDA ARR+QG+TK+VSRYPTFRRHF   V KLSEDL     +S    S          + R FS RSF+R  S N SDQESQ  ++R+ +I
Sbjct:    1 MEPPIGFRASLFQFLLFLPYFIGLLFLGFIKGIVLCPLVCLVVTIGNSAVILSLLPVHIVWTFYSIVSAKQVGPILKIFLCLCLPAAIILWPIVGILGSVLGGALYGFFSPIFATFDAVGEGKPYQFFHCFYDGTWSTMQRSFTVVRDFKDVCFHSYFSLMDELKQSCPDRKYYEIRLLQLPGALVVSVLGILVDPPVISLVAICKSPYMLFKGWHRLFHDLIGREGPFLETMCVPIAGLAILLWPLAVTGAVIGSVISSIFLGAYAGVVSYQESSFYYGLCYIVASVSIYDEYSTDILDLPEGSCFPRPKYRRKDEEPTPFSG---PVPRLGSVKNASSMRGGSVRVPMIDIKPLDLLNELFVECRRYGEVLATKGLINSKDIEEARSSKGSQVISVGLPAYGLLYEILRSVKANSSGLLLSDGVTEITTMNRPKDVFFDWFLNPFLILKEQMKATNLSEEEEEYLGRLVLLFGDPERLKSSNAISASPPLTERKRAELDAFARRMQGLTKTVSRYPTFRRHFVALVKKLSEDLDLKDNNSAKDESITEPPAPVKIISRIFSQRSFRRKGSVNGSDQESQKGVSRNVDI 587          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0N7B5_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2NLD7_GOSRA0.000e+096.52Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2RWN3_GOSRA0.000e+093.24Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0N313_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2NLE0_GOSRA0.000e+096.43Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2SRL4_GOSRA0.000e+097.75Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MMT3_GOSAR0.000e+076.07Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0B0MHG2_GOSAR0.000e+074.58Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2VXC8_GOSRA0.000e+076.07Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EJZ3_THECC0.000e+077.47Uncharacterized protein isoform 1 OS=Theobroma cac... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0017420 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y3739_ARATH0.000e+062.88Uncharacterized membrane protein At3g27390 OS=Arab... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31133FAMILY NOT NAMEDcoord: 2..573
NoneNo IPR availablePANTHERPTHR31133:SF3SUBFAMILY NOT NAMEDcoord: 2..573
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 34..55
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 174..207
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 109..173
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 253..258
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 28..33
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 208..226
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 227..252
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 56..74
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 259..279
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 6..27
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..5
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 280..573
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 75..108
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 6..28
NoneNo IPR availableTMHMMTMhelixcoord: 267..289
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 240..262

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0017420 ID=g.arboreum_cottongen_reftransV1_0017420|Name=g.arboreum_cottongen_reftransV1_0017420|organism=Gossypium arboreum|type=contig|length=2193bp
ATCACACCAATTAAGGACTTGAATTCTCAAGAATTTTGCAACTTAAAAGC
AGTGAAGCAGTCAAGTCCAAGTAATTTAGTGAATTACATTCATGCATGGT
TACTTTTGCTTGTTAACCAAACATTTGGAAACATTAACAACTCGAAATGA
ATGAACAAAGGCGGCCGGCCGTTGCATTTATGTCCAAAATCTGACAACTA
TGGACAAATATCAACATCCTAGTCCTACACCATTCGATTTCTACATCTCT
GGCAAGAACTGATTGTGATTCTTGATCGACATCCTATTCCTACATCATTC
GATTTCTGCATCTCTGGCAAGAACTGATTGTGATTCTTGATCAGACATGT
TTTGGCTTGAACTCCGCTTGAAAGATCTGCTGCTAAAAAACCGCAGAACG
GTGTTCTTCGATTGATGAGACCTATTACTAGATCTGCTGCTGTTGCTGCT
GCCACTGTCCTTTGAGAGATCCTCGGATAGTTTGTTAACAAATTCCTCAA
AGTGTCGCCTGAAAGTTGGATACCTCGACACTGATTTAGTAATACCTTGT
AACCGTCGGGCTAATGCATCAAGTTCAGCTCGTTTACGCTCTGATTCTGG
TGGAGACCCAATATTTTTCAACCGTGCTGCATCACCACACAGCAACACTA
ATTTGCCTAAGTAATCCTTTTCCTCCGGGGAAAGATTCTCTGCTCTGATT
TGCTCTTTCAGTATCAAAAAGGGGTTAAGAAACCAATCAAAGAATGAATC
TTTTGGTCGGTTCGTGGCCGTTATTTCTGTATTGTCACTCAGTAATATGC
CCAGTCTATTCGCATCCACAGAGCGCAAGAGTGCCTGAAGAAAGCAATAA
GCCGGTAAGCCGATGCTGACCACTCTACTTCCTTTGATAGACTTGGCATC
ATCGATGTCCTTAGAAGTTATCAGCCCTTCAGACACCATTTTCTCACCAT
GGACATGGCACTCCTTAAATAAGCCCTCGAGTAGCTGGAGTGGGTTCAAA
TCAAGCCTTGCATTTGTAAGTGAATCAATGCGAGCAGGAGGACGGAAGGA
GTCAGATTTAGAGAAGGATTCATTTCTATGCCTACGATACCGAGGCCTGG
GAAGGCAAGATCCTTCAGGCATGTCAAGGACATCAGTGCTGTATTCATCA
TATATGGACAACGAAGCAACGATATAACAAAGCCCATACCAAAACGAGGA
CTCCTGGTAAACAATCACCGCAGCATAGGCACCAAGGAAGATGCTAGACA
CAATTGAGCCCAACACTGCTCCAATGACAGCGAGTGGCCAAAGTAAGATG
GCAAGGCCTGCAAATGGTACACATATTGTCTCCAAGAAAGGGCCTTCTCG
ACCTACAAGGTCATGAAATAATCGATGCCACCCTTTAACGAGCATGTAAG
GACTTTTGCATAAGGCAATAAGTGAGATCATTGGAAAATCAACCAGAAAA
CCAAGCACTGCAGCTATAAGAGCCGGAAGCAGACAAAGGAATCTTATCTC
ATAGTATTGTCCATTTTTCTGTCGTAGTTCTTCCATAAACGAGTAGTAGG
AATGGACACAAACATCTTTGAAATCCTTGACAACAGTAAAGCTGCCCTTG
ATAGTGCTCCAAGTACCATCGTAAAAACAGTGGATAAACACATTGGTCTT
TCCTTCGCCCACAGCGTCAAAAGTGGCAAACATTGGTGAAAGAAAGCCGT
ATAATATTCCCCCTAAGATACTTCCAACAATGCCAACAACCACCCACAAT
ATCAAGACAACCGGTAGGAATATGCAGATAGCGAGCTTCAGAAATGGCCC
TAATAGTTTAGTGCTCACAATGCTATAATAAGTGAAGTAACAATGATAGG
GCAGAAGGCCTAATATGACGGACGAGTTTCCAATCGTCATGATAAGGCAT
ATCGGAGAGCAGAAAATGATTCCTTTAATTGTGCCTAAAAGAAGCAAGCC
AATGAAGTAAGGAAGAAAGCATATAAAGTTCCACAAAGTAGCTAAAAATC
CCTTGGGAGGCTCCATGTTTCGCCTAATATTTTACCTTCCAGATCTTCAT
AAAACTCACTACAATCCCATCCTAGAACTCAACCCCAGAATTTTCCCTGG
AAAATACCACTAAAATCCAAACTTTTATCATATCCCAGATCCAAAAAAGA
TAATAGAAAAAAAAAAGAAAGCAAATAGAAAAACAAAAACCCA
back to top