g.arboreum_cottongen_reftransV1_0013834, g.arboreum_cottongen_reftransV1_0013834 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0013834
Unique Nameg.arboreum_cottongen_reftransV1_0013834
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1987
Homology
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A0D2UPY7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G066000 PE=3 SV=1)

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 494/505 (97.82%), Postives = 498/505 (98.61%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSRYDSRSGDP SYRDRRSDSGFGGASAYGGSGRSLSSRKDYDA EPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQ+REITVEGRDVPKPVKSFADV FPDYVLQEV KAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHV+IVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAIL+EAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGY G R W+
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGASAYGGSGRSLSSRKDYDAAEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQRREITVEGRDVPKPVKSFADVGFPDYVLQEVSKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYGGSRPWN 505          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A0B0MHH3_GOSAR (DEAD-box ATP-dependent RNA helicase 20-like protein OS=Gossypium arboreum GN=F383_19398 PE=3 SV=1)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 499/519 (96.15%), Postives = 502/519 (96.72%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFR--------------DRGKGYSGGRTWS 1719
            MSRYDSRSGDPASYRDRRSDSGFGGASAYGGSGRSLSSRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHV+IVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAIL+EAGQKVSPELAAMGRGAPPPPSGHGGFR              DRGKGY G R W+
Sbjct:    1 MSRYDSRSGDPASYRDRRSDSGFGGASAYGGSGRSLSSRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQKVSPELAAMGRGAPPPPSGHGGFRVRDRDRDRDRDRDRDRGKGYGGSRPWN 519          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A0B0PIE4_GOSAR (DEAD-box ATP-dependent RNA helicase 20-like protein OS=Gossypium arboreum GN=F383_00152 PE=3 SV=1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 484/505 (95.84%), Postives = 495/505 (98.02%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSRYDSRSGDP SYRDRRSDSGFGGASAYGGS RS SSR+DYD  EPPRKLDLDGLTPFEKNFY+ESPSVAAMS+ EVE+YR++REITVEGRDVPKPV SF D+ FPDYVLQE+ KAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+S+HTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKV+IGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGASAYGGSVRSSSSRRDYDGAEPPRKLDLDGLTPFEKNFYIESPSVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDYVLQEITKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVVIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 505          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A0D2TPW0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G140700 PE=3 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 480/505 (95.05%), Postives = 491/505 (97.23%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSRYDSRSGDP SYRDRRSDSGFGGASAY GS RS SSR+DYD  EPPRKLDLDGLTPFEKNFY+ESP VAAMS+ EVE+YR++REITVEGRDVPKPV SF D+ FPDYVLQE+ KAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+S+HTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKV+IGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWP LSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGR WS
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGASAYDGSVRSSSSRRDYDGAEPPRKLDLDGLTPFEKNFYIESPLVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDYVLQEITKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVVIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRPWS 505          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A061GD47_THECC (DEA(D/H)-box RNA helicase family protein OS=Theobroma cacao GN=TCM_029008 PE=3 SV=1)

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 475/502 (94.62%), Postives = 485/502 (96.61%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGR 1710
            MSRYDSRSGDP SYRDRRSDSGFGGASAYGGS RS SSR+DYD  EPPRKLDLDGLTPFEKNFYVESP VAAMS  EVEEYRQ+REITVEGRDVPKPVKSF D+ FP+YVLQE+ KAGFVEPT IQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+SHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHV+IV ESQKY+KLVKLLEDIMDGSRILIFMDTKKGCDQITR+LRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI ILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRG+GY   R
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGASAYGGSMRSSSSRRDYDGAEPPRKLDLDGLTPFEKNFYVESPLVAAMSATEVEEYRQRREITVEGRDVPKPVKSFRDMGFPEYVLQEITKAGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVDIVPESQKYSKLVKLLEDIMDGSRILIFMDTKKGCDQITRRLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIVILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGRGYGSSR 502          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A0D2ULQ3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G140700 PE=3 SV=1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 463/487 (95.07%), Postives = 474/487 (97.33%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSG 1665
            MSRYDSRSGDP SYRDRRSDSGFGGASAY GS RS SSR+DYD  EPPRKLDLDGLTPFEKNFY+ESP VAAMS+ EVE+YR++REITVEGRDVPKPV SF D+ FPDYVLQE+ KAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+S+HTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKV+IGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWP LSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSG
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGASAYDGSVRSSSSRRDYDGAEPPRKLDLDGLTPFEKNFYIESPLVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDYVLQEITKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVVIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSG 487          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: B9MWR8_POPTR (DEAD box RNA helicase family protein OS=Populus trichocarpa GN=POPTR_0003s03040g PE=3 SV=1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 448/505 (88.71%), Postives = 466/505 (92.28%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSRYDSRSGDP SYRDRRS  G     +          R+++  G+ P K DLDGLTPFEKNF+VESPSVAAMSE +VEEYR +REITVEGRDVPKPVKSF DV FPDYVLQE+ KAGF EPT IQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAI+HVNAQP LAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDM++SHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQ LYNPYKVIIGS DLKANHAIRQHV+IVSE+QKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTA NARFAKEL+ ILEEAGQKVSPEL AM RGAPP  SGHGGFRDRG+GYSGGR+W+
Sbjct:    1 MSRYDSRSGDPTSYRDRRSYGGGSTRPSSE--------RREHGRGDSPAKSDLDGLTPFEKNFHVESPSVAAMSERDVEEYRLRREITVEGRDVPKPVKSFHDVGFPDYVLQEISKAGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIIHVNAQPFLAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQSLYNPYKVIIGSPDLKANHAIRQHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELVTILEEAGQKVSPELTAMARGAPPLLSGHGGFRDRGRGYSGGRSWN 497          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: B9SN43_RICCO (Dead box ATP-dependent RNA helicase, putative OS=Ricinus communis GN=RCOM_0312580 PE=3 SV=1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 458/486 (94.24%), Postives = 471/486 (96.91%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPS 1662
            MSRYDSRSGDP SYRDRRSDSGFGGA AYGGSGRS S R++YD    PRK DLDGLTPFEKNFYVESPSVAAMSE EVEEYRQ+REITVEGRDVPKPVKSF DV FPDYVL+EV +AGFVEPT IQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA KFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+SHHTNLRRVTYLVLDEADRMLDMGF+PQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKV+IGSADLKANHAIRQHV+IVSE+QKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTA+NARFAKELI+ILEEAGQKVSPELAAMGRGAPPPPS
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGALAYGGSGRSSSERREYDRAISPRKSDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQRREITVEGRDVPKPVKSFRDVGFPDYVLEEVTRAGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEATKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVVIGSADLKANHAIRQHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELISILEEAGQKVSPELAAMGRGAPPPPS 486          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: A0A067L0P3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_24777 PE=3 SV=1)

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 466/505 (92.28%), Postives = 483/505 (95.64%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSRYDSRSGDP SYRDRRSDSGFGG S Y GS RS S R+DY A + PRK DLDGLTPFEKNFY+ESPSVAAMSE EV+EYRQ+REITVEGRDVPKPVKSF D+ FP+YVLQE+ KAGFVEPT IQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRE AVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDML+SHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGS DLKANHAIRQHV+IVSE+QKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALS+HGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTA+NARFAKELI ILEEAGQKVSPELAAMGRGAPPPP G+G FR+RG+GY GGR+WS
Sbjct:    1 MSRYDSRSGDPTSYRDRRSDSGFGGGSVYSGSARSSSERRDYGA-DSPRKSDLDGLTPFEKNFYIESPSVAAMSEREVDEYRQRREITVEGRDVPKPVKSFRDMGFPEYVLQEITKAGFVEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTREHAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSPDLKANHAIRQHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSLHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELITILEEAGQKVSPELAAMGRGAPPPP-GYGSFRERGRGYGGGRSWS 503          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Match: F6HY13_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_09s0002g02100 PE=3 SV=1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 451/514 (87.74%), Postives = 476/514 (92.61%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXX-RKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSG---------HGGFRDRGKGYSGGRTW 1716
            MSRYD RSGDP SYRDRRS+SGFGGAS YG  G   SS ++D D  E PRK DLDGLTPFEKNFYVESP+VAAMSE EVE+YR++REITVEGRDVPKPV +F DV  P+YV+QE+ KAGF EPT IQAQGWPMALKGRD+IGIAETGSGKTLAYLLPAI+HVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCI+GGVPKGPQ+RDLQKGVEIVIATPGRLIDML+SHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLAR+FLYNP KV+IGSADLKANHAIRQHV IVSE+QKYN+LVKLLEDIMDG RILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI ILEEAGQ+V+PELAAMGRGAPPPPSG         HGGFRDRG+G+  GR W
Sbjct:    1 MSRYDGRSGDPGSYRDRRSESGFGGASGYGSGGVRSSSSKRDLDGVESPRKPDLDGLTPFEKNFYVESPAVAAMSEKEVEQYRERREITVEGRDVPKPVMNFRDVGLPEYVMQEITKAGFAEPTPIQAQGWPMALKGRDVIGIAETGSGKTLAYLLPAIIHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIHGGVPKGPQIRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARKFLYNPCKVVIGSADLKANHAIRQHVEIVSENQKYNRLVKLLEDIMDGGRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQRVAPELAAMGRGAPPPPSGQLDSPPAQRHGGFRDRGRGHGSGRAW 514          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: RH20_ARATH (DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 431/501 (86.03%), Postives = 468/501 (93.41%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRG--KGYS 1701
            MSRYDSR+GD  SYRDRRSDSGFGG S+YG SG   SS+KD D  E PRKLDLDGLTPFEKNFYVESP+VAAM++ EVEEYR+ REITVEG+D+PKPVKSF DV FPDYVL+EV KAGF EPT IQ+QGWPMA+KGRDLIGIAETGSGKTL+YLLPAIVHVNAQP+LA GDGPIVLVLAPTRELAVQIQQEA+KFG+SS+IK TCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDM++S++TNLRRVTYLVLDEADRMLDMGF+PQIRKIVS IRPDRQTLYWSATWPKEVEQL+++FLYNPYKVIIGS+DLKAN AIRQ V+++SESQKYNKLVKLLEDIMDGSRIL+F+DTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFT ANARFAKEL  IL+EAGQKVSPELA+MGR   PPP G GGFRDRG  +G+S
Sbjct:    1 MSRYDSRTGDSTSYRDRRSDSGFGGTSSYGSSGSHTSSKKDNDGNESPRKLDLDGLTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPMAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPMLAHGDGPIVLVLAPTRELAVQIQQEASKFGSSSKIKTTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGSSDLKANRAIRQIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKVSPELASMGRSTAPPPPGLGGFRDRGSRRGWS 501          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: RH20_ORYSJ (DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 427/505 (84.55%), Postives = 452/505 (89.50%), Query Frame = 1
Query:  205 MSRYDSRSGDPASYRDRRXXXXXXXXXXXXXXXXXXXXRKDYDAGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            MSR+D R+ DP SYRDRRS+  FGG +          S             DLDGL  FEKNFYVESPSVA M+E EVE YR++REITVEGRDVPKPV+ F DV FP+YVLQE+ KAGFVEPT IQ+QGWPMAL+GRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA KFGASS+IK+TCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDM++SHHTNLRRVTYLVLDEADRMLDMGFEPQI+KIVSQIRPDRQTLYWSATWPKEVEQLAR FL++PYKVIIGS +LKANHAI QHV I+SESQKYNKLV LLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAK+LI ILEEAGQKVSPELA MGRGAPPP SGH   RDR +GY GGR+WS
Sbjct:    1 MSRFDGRAADPGSYRDRRSEGAFGGGTRAFAPTSKADSAAA--------AADLDGLPRFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEYVLQEITKAGFVEPTPIQSQGWPMALRGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEATKFGASSKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMIESHHTNLRRVTYLVLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKEVEQLARNFLFDPYKVIIGSEELKANHAISQHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANMGRGAPPPSSGH---RDRYRGYGGGRSWS 494          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: RH30_ORYSJ (DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 334/456 (73.25%), Postives = 391/456 (85.75%), Query Frame = 1
Query:  352 KLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGRGAPPPPSGHGGFRDRGKGYSGGRTWS 1719
            K D   L PFEKNFYVE P+V AMS+M+V +YR++R+ITVEG DVPKPV+ F +  FPDY +Q + K+GFVEPT IQ+QGWPMALKGRD+IGIA+TGSGKTL+YLLP +VHV AQP L  GDGPIVL+LAPTRELAVQIQQE+ KFG+ SR ++TCIYGG PKGPQ+RDL++GVEIVIATPGRLIDML+  HTNLRRVTYLVLDEADRMLDMGFEPQIRKIV+QIRPDRQTLYWSATWP+EVE LARQFL NPYKVIIGS DLKANH+I+Q + ++SE +KY +L KLL D+MDGSRILIF  TKK CD++TRQLRMDGWPALSIHGDK+QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VIN+DFP +LEDY+HRIGRTGRAGA GTA+TFFT +NA+F++ L+ IL EAGQ V+P L +M + A     G G FR RG+G  G R+ S
Sbjct:  202 KPDFRSLIPFEKNFYVECPAVQAMSDMDVSQYRRQRDITVEGHDVPKPVRYFQEANFPDYCMQAIAKSGFVEPTPIQSQGWPMALKGRDMIGIAQTGSGKTLSYLLPGLVHVGAQPRLEQGDGPIVLILAPTRELAVQIQQESGKFGSYSRTRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEGGHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVAQIRPDRQTLYWSATWPREVESLARQFLQNPYKVIIGSPDLKANHSIQQIIEVISEHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQVVNPALESMAKSA--SSMGGGNFRSRGRGGFGNRSGS 655          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: RH30_ARATH (DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 318/430 (73.95%), Postives = 373/430 (86.74%), Query Frame = 1
Query:  352 KLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            K +   L  FEKNFYVESP+V AM+E +V  YR +R+I+VEGRDVPKP+K F D  FPD +L+ + K GF EPT IQAQGWPMALKGRDLIGIAETGSGKTLAYLLPA+VHV+AQP L   DGPIVL+LAPTRELAVQIQ+E+ KFG  S +++TCIYGG PKGPQ+RDL++GVEIVIATPGRLIDML+  HTNL+RVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTL WSATWP+EVE LARQFL +PYK IIGS DLKAN +I Q + IV   +KYN+L+ LL+ +MDGS+ILIF++TK+GCDQ+TRQLRMDGWPAL+IHGDK+Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAGAKG A+TFFT  NA+FA+EL+ IL+EAGQ V P L+A+ R
Sbjct:  116 KQNFGNLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRSGVRSTCIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDLKANQSINQVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELVKILQEAGQVVPPTLSALVR 545          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_NEOFI (ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1)

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 302/438 (68.95%), Postives = 358/438 (81.74%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMD--GSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            AG   +  DLD L  FEK+FY E P VAA SE EVEE+R+K E+TV+GR+VP+PV++F +  FP YVL EV   GF  PTAIQ+QGWPMAL GRD++GIAETGSGKTL Y LPAIVH+NAQP+LAPGDGPIVL+LAPTRELAVQIQ E +KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKI+SQIRPDRQT  WSATWPKEV QLA  FL +  +V IGS DL ANH I Q V +VS+ +K +K++K LE IM+  G++ LIF  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +V+NYD+P + EDY+HRIGRTGRAGAKGTA TFFT  N++ A++L+ IL EA Q++ P LA M R
Sbjct:   64 AGLKKQDWDLDTLPKFEKSFYKEHPDVAARSEREVEEFRKKHEMTVQGRNVPRPVENFDEAGFPQYVLSEVKAQGFERPTAIQSQGWPMALSGRDVVGIAETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLILAPTRELAVQIQTEISKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQTCMWSATWPKEVRQLATDFLNDYIQVNIGSMDLSANHRITQIVEVVSDFEKRDKMIKHLEKIMENRGNKCLIFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVLNYDYPNNSEDYIHRIGRTGRAGAKGTAITFFTTENSKQARDLVTILTEAKQQIDPRLAEMVR 501          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_EMENI (ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 301/438 (68.72%), Postives = 359/438 (81.96%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMD--GSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            +G   +  DLD L  FEK+FY E P V A S+ EV+E+R+K E+TV+GRDVP+PV++F +  FP YVL EV   GF +PTAIQ+QGWPMAL GRD++GIAETGSGKTL+Y LPAIVH+NAQP+LAPGDGPIVL+LAPTRELAVQIQ E +KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKI+SQIRPDRQT  WSATWPKEV QLA  FL N  +V IGS DL ANH I Q V ++SE +K ++++K LE IM+  G++ L+F  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +VINYD+P + EDYVHRIGRTGRAGAKGTA TFFT  NA+ A++L+ IL EA Q++ P LA M R
Sbjct:   85 SGLKKQDWDLDTLPKFEKSFYKEHPDVTARSQREVDEFRKKCEMTVQGRDVPRPVETFDEAGFPQYVLSEVKAQGFEKPTAIQSQGWPMALSGRDVVGIAETGSGKTLSYCLPAIVHINAQPLLAPGDGPIVLILAPTRELAVQIQAEISKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQTCMWSATWPKEVRQLASDFLNNYIQVNIGSMDLSANHRITQIVEVISEFEKRDRMIKHLEKIMENRGNKCLVFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVINYDYPNNSEDYVHRIGRTGRAGAKGTAITFFTTDNAKQARDLVTILSEAKQQIDPRLAEMVR 522          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_ASPFU (ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 302/438 (68.95%), Postives = 357/438 (81.51%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMDG--SRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            AG   +  DLD L  FEK+FY E P VAA SE EVEE+R+K E+TV+GR+VP+PV++F +  FP YVL EV   GF  PTAIQ+QGWPMAL GRD++GIAETGSGKTL Y LPAIVH+NAQP+LAPGDGPIVL+LAPTRELAVQIQ E +KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQT  WSATWPKEV QLA  FL +  +V IGS DL ANH I Q V +VS+ +K +K++K LE IM+   ++ LIF  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +V+NYD+P + EDY+HRIGRTGRAGAKGTA TFFT  N++ A++L+ IL EA Q++ P LA M R
Sbjct:   66 AGLKKQDWDLDSLPKFEKSFYKEHPDVAARSEREVEEFRKKHEMTVQGRNVPRPVENFDEAGFPQYVLSEVKAQGFERPTAIQSQGWPMALSGRDVVGIAETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLILAPTRELAVQIQAEISKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTCMWSATWPKEVRQLATDFLNDYIQVNIGSMDLSANHRITQIVEVVSDFEKRDKMIKHLEKIMENRSNKCLIFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVLNYDYPNNSEDYIHRIGRTGRAGAKGTAITFFTTENSKQARDLVTILTEAKQQIDPRLAEMAR 503          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_ASPCL (ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 297/436 (68.12%), Postives = 357/436 (81.88%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMD--GSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAM 1635
            AG   ++ DL+ L  FEK+FY E P V A S+ EV+E+RQ+ ++TV+G++VP+PV++F +  FP YVL EV   GF  PTAIQ+QGWPMAL GRD++GIAETGSGKTL Y LPAIVH+NAQP+LAPGDGPIVLVLAPTRELAVQIQ E  KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKI+SQIRPDRQT  WSATWPKEV QLA  FL +  +V IGS DL ANH I Q V +VS+ +K +K++K LE IM+   ++ILIF  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFKAGKSPIM ATDVA+RG+DV+D+ +V+NYD+P + EDY+HRIGRTGRAGAKGTA TFFT  N++ A++L+ IL EA Q++ P LA M
Sbjct:   70 AGLKKQEWDLETLPKFEKSFYKEHPDVTARSQREVDEFRQEHKMTVQGKNVPRPVETFDEAGFPQYVLSEVKSQGFERPTAIQSQGWPMALSGRDVVGIAETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTEITKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQTCMWSATWPKEVRQLASDFLNDYIQVNIGSMDLSANHRITQIVEVVSDFEKRDKMIKHLEKIMEDRSNKILIFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKAGKSPIMVATDVASRGIDVRDITHVLNYDYPNNSEDYIHRIGRTGRAGAKGTAITFFTTDNSKQARDLVTILTEAKQQIDPRLAEM 505          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_ASPOR (ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 297/438 (67.81%), Postives = 358/438 (81.74%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMD--GSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            AG   ++ DLD L  FEK+FY E P VA  S+ +V+E+R+K E++V+G+++P+PV++F +  FP YVL EV   GF  PTAIQ+QGWPMAL GRD++GIAETGSGKTL+Y LPAIVH+NAQP+LAPGDGPIVLVLAPTRELAVQIQ E  KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKI+SQIRPDRQT  WSATWPKEV QLA  FL +  +V IGS DL ANH I Q V +VS+ +K +K++K LE IM+  G++ LIF  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +V+NYD+P + EDYVHRIGRTGRAGAKGTA TFFT  N++ A++L+ IL EA Q++ P LA M R
Sbjct:   75 AGLKKQEWDLDSLPKFEKSFYKEHPDVANRSQRDVDEFRKKFEMSVQGKNIPRPVETFDEAGFPQYVLSEVKAQGFERPTAIQSQGWPMALSGRDVVGIAETGSGKTLSYCLPAIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQAEITKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQTCMWSATWPKEVRQLASDFLNDYIQVNIGSMDLSANHRITQIVEVVSDFEKRDKMIKHLEKIMENRGNKCLIFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVLNYDYPNNSEDYVHRIGRTGRAGAKGTAITFFTTDNSKQARDLVTILTEAKQQIDPRLAEMVR 512          
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Match: DBP2_ASPNC (ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 296/438 (67.58%), Postives = 355/438 (81.05%), Query Frame = 1
Query:  334 AGEPPRKLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDYVLQEVMKAGFVEPTAIQAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEAAKFGASSRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLDSHHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSADLKANHAIRQHVNIVSESQKYNKLVKLLEDIMD--GSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHXXXXXXXXXXXXXXXXFFTAANARFAKELIAILEEAGQKVSPELAAMGR 1641
            AG   ++ DLD L  FEK+FY E   VA  S+ +V+E+R+K E+ V+GR+VP+PV++F +  FP YVL EV   GF  PTAIQ+QGWPMAL GRD++GIAETGSGKTL Y LPAIVH+NAQP+LAPGDGPIVL+LAPTRELAVQIQ E +KFG SSRI+NTC+YGGVPKGPQ+RDL +GVE+ IATPGRLIDML++  TNLRRVTYLVLDEADRMLDMGFEPQIRKI+SQIRPDRQT  WSATWPKEV QLA  FL +  +V IGS DL ANH I Q V +VS+ +K +K++K LE IM+   ++ LIF  TK+  D+ITR LR DGWPALSIHGDK Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +V+NYD+P + EDYVHRIGRTGRAGAKGTA TFFT  N++ A++L+ IL EA Q++ P LA M R
Sbjct:   82 AGLKKQEWDLDSLPKFEKSFYKEHADVAERSQRDVDEFRKKHEMAVQGRNVPRPVETFDEAGFPQYVLSEVKAQGFDRPTAIQSQGWPMALSGRDVVGIAETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLILAPTRELAVQIQAEISKFGKSSRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGRTNLRRVTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQTCMWSATWPKEVRQLASDFLNDYIQVNIGSMDLSANHRITQIVEVVSDFEKRDKMIKHLEKIMENRANKCLIFTGTKRIADEITRFLRQDGWPALSIHGDKQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVLNYDYPNNSEDYVHRIGRTGRAGAKGTAITFFTTDNSKQARDLVTILTEAKQQIDPRLAEMVR 519          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2UPY7_GOSRA0.000e+097.82Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0MHH3_GOSAR0.000e+096.15DEAD-box ATP-dependent RNA helicase 20-like protei... [more]
A0A0B0PIE4_GOSAR0.000e+095.84DEAD-box ATP-dependent RNA helicase 20-like protei... [more]
A0A0D2TPW0_GOSRA0.000e+095.05Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GD47_THECC0.000e+094.62DEA(D/H)-box RNA helicase family protein OS=Theobr... [more]
A0A0D2ULQ3_GOSRA0.000e+095.07Uncharacterized protein OS=Gossypium raimondii GN=... [more]
B9MWR8_POPTR0.000e+088.71DEAD box RNA helicase family protein OS=Populus tr... [more]
B9SN43_RICCO0.000e+094.24Dead box ATP-dependent RNA helicase, putative OS=R... [more]
A0A067L0P3_JATCU0.000e+092.28Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
F6HY13_VITVI0.000e+087.74Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0013834 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
RH20_ARATH0.000e+086.03DEAD-box ATP-dependent RNA helicase 20 OS=Arabidop... [more]
RH20_ORYSJ0.000e+084.55DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sa... [more]
RH30_ORYSJ0.000e+073.25DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sa... [more]
RH30_ARATH0.000e+073.95DEAD-box ATP-dependent RNA helicase 30 OS=Arabidop... [more]
DBP2_NEOFI0.000e+068.95ATP-dependent RNA helicase dbp2 OS=Neosartorya fis... [more]
DBP2_EMENI0.000e+068.72ATP-dependent RNA helicase dbp2 OS=Emericella nidu... [more]
DBP2_ASPFU0.000e+068.95ATP-dependent RNA helicase dbp2 OS=Neosartorya fum... [more]
DBP2_ASPCL0.000e+068.12ATP-dependent RNA helicase dbp2 OS=Aspergillus cla... [more]
DBP2_ASPOR0.000e+067.81ATP-dependent RNA helicase dbp2 OS=Aspergillus ory... [more]
DBP2_ASPNC0.000e+067.58ATP-dependent RNA helicase dbp2 OS=Aspergillus nig... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 118..321
e-value: 2.4E-68
score: 243.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 130..305
score: 33.408
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 358..439
e-value: 4.8E-34
score: 129.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 330..439
e-value: 1.5E-29
score: 102.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 333..478
score: 23.963
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 321..476
e-value: 9.9E-60
score: 200.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 80..320
e-value: 2.3E-91
score: 304.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 171..454
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 123..294
e-value: 4.2E-49
score: 166.5
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 7..477
NoneNo IPR availablePANTHERPTHR24031:SF219ATP-DEPENDENT RNA HELICASE DDX5-RELATEDcoord: 7..477
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 251..259
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 99..127
score: 10.209

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0013834 ID=g.arboreum_cottongen_reftransV1_0013834|Name=g.arboreum_cottongen_reftransV1_0013834|organism=Gossypium arboreum|type=contig|length=1987bp
GGAAAATTTTTCCCTTTCTCTTAACTTCTTTTCCTCCCAATTGAAACCAA
AAAGGAGAGGGACAAAGCTCCATCGAGTAAAACCCTGACACATAAAAACC
CTAATTAATTAGAACAAGGCCAAACGATAACACGAATTCTTTTTTTCGGT
TACATTGACATTTATATTAACTTTTGATCATTTCTACGGACAGCAGCACA
TAAAATGAGTAGATATGATAGCCGCTCCGGCGATCCTGCCTCCTACCGTG
ACCGTAGAAGTGACTCAGGGTTTGGTGGGGCTTCAGCATATGGTGGTTCA
GGGCGGTCCTTGTCAAGCAGAAAGGACTATGATGCTGGTGAACCACCTAG
GAAGTTGGATTTGGATGGCTTGACACCATTTGAAAAGAATTTTTATGTTG
AGTCTCCTTCTGTGGCAGCAATGTCTGAGATGGAGGTGGAGGAATATCGA
CAGAAGAGGGAAATTACGGTTGAAGGTCGTGATGTTCCAAAGCCTGTGAA
GAGTTTTGCTGATGTGAGATTTCCAGACTATGTACTGCAAGAAGTCATGA
AAGCAGGGTTTGTTGAACCAACAGCCATACAAGCTCAAGGCTGGCCAATG
GCTTTAAAGGGCCGTGATCTTATTGGTATTGCTGAAACAGGATCAGGGAA
GACCCTTGCCTATTTATTGCCTGCAATTGTTCACGTCAACGCACAACCAA
TTTTAGCTCCTGGAGATGGTCCAATTGTATTAGTATTAGCTCCCACACGT
GAACTTGCAGTTCAAATACAACAGGAGGCTGCTAAGTTTGGTGCGTCATC
AAGGATCAAGAATACATGCATATATGGTGGGGTTCCAAAGGGACCTCAAG
TGCGTGATCTCCAGAAAGGTGTTGAGATTGTTATTGCTACACCAGGAAGG
TTAATAGATATGTTGGATTCACATCACACAAATCTGCGAAGAGTTACTTA
TTTAGTCTTGGATGAGGCAGATCGGATGTTAGACATGGGGTTTGAGCCTC
AGATACGAAAAATTGTTTCTCAGATACGTCCTGATCGTCAAACTTTATAC
TGGAGTGCAACTTGGCCAAAGGAGGTTGAACAATTGGCAAGGCAGTTTCT
TTACAATCCGTACAAAGTGATAATTGGATCTGCGGATTTAAAAGCTAACC
ATGCAATTCGCCAACATGTTAACATTGTTTCAGAGAGTCAGAAATATAAC
AAATTGGTGAAGCTGCTCGAGGATATCATGGATGGCAGCAGAATTTTGAT
TTTCATGGATACCAAGAAGGGTTGTGACCAAATCACTAGGCAACTTCGCA
TGGATGGTTGGCCTGCTCTGTCAATTCATGGAGATAAAAGTCAAGCAGAA
AGGGATTGGGTCCTTTCAGAGTTTAAAGCTGGCAAGAGCCCTATAATGAC
TGCAACAGATGTTGCAGCTCGTGGTTTAGATGTGAAAGATGTGAAGTATG
TAATCAATTATGACTTCCCGGGATCTCTCGAGGATTATGTCCATCGCATT
GGTCGAACAGGGAGGGCTGGGGCAAAAGGAACAGCCTATACTTTCTTCAC
AGCTGCAAATGCAAGATTTGCCAAAGAACTTATTGCCATACTTGAGGAAG
CTGGCCAGAAGGTCAGTCCTGAATTGGCAGCAATGGGACGCGGTGCACCT
CCTCCCCCATCAGGTCATGGTGGTTTTCGAGACCGAGGTAAGGGATACAG
TGGCGGTCGCACATGGAGCTGATTAACAGAAAGATCCCTGTTCCCCAGAA
GAGGAAAATTAGAAAGACTATGAGGGTACAGTGTAGTGTAGACATACTTT
GTTTAACTGTCACTACCCGCAGGAAGGGCAAGTAGATGGGGAACTTGTAA
ATTGACAGTGTATGTACTCCCAGATTAAAAGTCCGATTCCCCCTTAAGCA
ATGAGAACTCAACTCGTGAATGAAAAACAAAACAAAAATGAGTTGCATTT
TTCCACTTCATTCCAAAGCTGATCATGTTTTTTTTTT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding