g.arboreum_cottongen_reftransV1_0004526, g.arboreum_cottongen_reftransV1_0004526 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0004526
Unique Nameg.arboreum_cottongen_reftransV1_0004526
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length3025
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr9chromosomeg.arboreum_cottongen_reftransV1_0004526:1..3025 .
Chr9:52496243..52501317 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: A0A0B0NPM1_GOSAR (Transcription initiation factor TFIID subunit 1-A-like protein OS=Gossypium arboreum GN=F383_03352 PE=4 SV=1)

HSP 1 Score: 1140.95 bits (2950), Expect = 0.000e+0
Identity = 762/764 (99.74%), Postives = 762/764 (99.74%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPXXXXXXXXXXXXXXXXXXXXXXXXXXXDRARKXXXXXXXXXXXXXXFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEDYXXXXXXXXXXXXXXGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEEGNNNNKVDKADAVKGLKMRRRPYKAQAEEEIEDEAAEAAELCRLLMDDEDDQKKKKKKKNKAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDN  LFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIRPPADKDKDQPQKKIIIKRPKEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPKARRKAKEERRWWEEEEKRRNVERIREDRARKLYEEEMRLLEERERFAEITRYTEDIRREREEEERQKAKKKKKKKAEIKEDYLEDYRTRRNDRRAPERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL
Sbjct: 1123 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEEGNNNNKVDKADAVKGLKMRRRPYKAQAEEEIEDEAAEAAELCRLLMDDEDDQKKKKKKKNKAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDN--LFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIRPPADKDKDQPQKKIIIKRPKEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPKARRKAKEERRWWEEEEKRRNVERIREDRARKLYEEEMRLLEERERFAEITRYTEDIRREREEEERQKAKKKKKKKAEIKEDYLEDYRTRRNDRRAPERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 1884          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: A0A0D2UTN8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G137400 PE=4 SV=1)

HSP 1 Score: 1128.24 bits (2917), Expect = 0.000e+0
Identity = 754/764 (98.69%), Postives = 758/764 (99.21%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPXXXXXXXXXXXXXXXXXXXXXXXXXXXDRARKXXXXXXXXXXXXXXFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEDYXXXXXXXXXXXXXXGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEEGNNNNKVDKADAVKGLKMRRRPYKAQAEEEIEDEAAEAAELCRLLMDDEDDQKKKKKKKNKAVTEDAGLTFGLQPRIGVESLQ VKKTSIIPKQIVRSTQSNGSYP+NEN VKDTKDIESRIFKGSVSGKLKGMKKNGMP+TGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSD PVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESH +PVVIRHQVDTDRGQAESHKKSIVIKPP NMERDQVEPHKPSVVIRPPADKDKDQPQKKIIIKRPKEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPKARRKAKEERRWWEEEEKRRNVERIREDRARKLYEEEMRLLEERERFAEITRYTEDIRREREEEERQKAKKKKKKKAEIKEDYLEDYRTRRNDRRAPERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHE SD+L
Sbjct: 1120 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEEGNNNNKVDKADAVKGLKMRRRPYKAQAEEEIEDEAAEAAELCRLLMDDEDDQKKKKKKKNKAVTEDAGLTFGLQPRIGVESLQCVKKTSIIPKQIVRSTQSNGSYPLNENIVKDTKDIESRIFKGSVSGKLKGMKKNGMPNTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDIPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHNVPVVIRHQVDTDRGQAESHKKSIVIKPPTNMERDQVEPHKPSVVIRPPADKDKDQPQKKIIIKRPKEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPKARRKAKEERRWWEEEEKRRNVERIREDRARKLYEEEMRLLEERERFAEITRYTEDIRREREEEERQKAKKKKKKKAEIKEDYLEDYRTRRNDRRAPERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHEYSDNL 1883          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: A0A061ER02_THECC (Histone acetyltransferase, putative OS=Theobroma cacao GN=TCM_019910 PE=4 SV=1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 648/765 (84.71%), Postives = 695/765 (90.85%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLMEPXXXXXXXXXXXXXXXXXXXXXXXXXXXDRARKXXXXXXXXXXXXXXFAX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEDYXXXXXXXXXXXXXXGAKRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEE NN+NK+DK D VKGLKMRRRP KAQAEEEIEDEAAEAAELCRLLMDD+D+QKKKKKKKNKAV  D GL+FGLQ RI  E++QRVKK S I KQIV +TQ NGSY  NEN VKD KDIESR+FKG++SGK+KGMKKNGM STGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNK+CPKYGEDPE QV+A + EK  GKST LEPSG SQLK MKKKLI KSATKIAVVEASEGEKSS+N KA PLKFKCSTDRPSDKL SG TQSSD+ VTSDPE+G KS AKVSKIIISNRAKPDEMQVES KLP VIRHQ+D DRGQAESHK+SIVI+PP NMERDQVEPHKPSVVIRPPADKD++QP KKIIIKRPKE+IDLDQ+ QEGGTYPEYRKTKKIVELSSFEKHGKQESLRL E  ARRKAKEE+ WWEEE+KRRN+E +RE+RARKLYEE++R LEERERFAE      +  R   EEE ++  +KKKKKKA+IK+DYLEDYRTRRNDRR  ERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGL+N+LERI ETLRDNTE+SYLFLKPVSKKEAPDYL+I+K PMDLSTIRDKVRRMEYK++EEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYL+ E   SL
Sbjct: 1123 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSAVDGEENESDSEANSDLDSFAGDLENLLDAEEFEEGEEVNNDNKIDKVDGVKGLKMRRRPSKAQAEEEIEDEAAEAAELCRLLMDDDDEQKKKKKKKNKAVAGDVGLSFGLQSRISSENVQRVKKASTISKQIVGATQPNGSYTTNENIVKDPKDIESRMFKGNLSGKVKGMKKNGMSSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKNCPKYGEDPELQVDAADFEKPSGKSTLLEPSGLSQLKTMKKKLIPKSATKIAVVEASEGEKSSSNAKAFPLKFKCSTDRPSDKLASGATQSSDYQVTSDPESGIKSVAKVSKIIISNRAKPDEMQVESQKLPFVIRHQMDNDRGQAESHKRSIVIRPPTNMERDQVEPHKPSVVIRPPADKDREQPHKKIIIKRPKEIIDLDQICQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLTEQTARRKAKEEKGWWEEEQKRRNMEMLREERARKLYEEKLRALEERERFAEITRYTEDIRREREEEERQKAKRKKKKKKADIKDDYLEDYRTRRNDRRTLERDRGAKRKPVELGRYGAEYVPPTKRRRGGEVGLSNVLERIAETLRDNTELSYLFLKPVSKKEAPDYLDIIKRPMDLSTIRDKVRRMEYKDREEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLMDEYHQSL 1887          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: F6H596_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0028g03940 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 8.169e-151
Identity = 357/549 (65.03%), Postives = 417/549 (75.96%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPL-TKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEP--------------------HKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLME 1581
            +IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSAVD +E ESDSEANSDLDSFAGDLENLLDAEE E+GEEGN  +K D+ D V+GLKMRRRP +AQAEEEIEDEAAEAAELCR+LMDD D+ ++KKKKK + V E+ GL  G Q   G E+ Q++KK S + KQ+V   Q +GSY   E   +D+K++ES + K ++SGK K +KKN     G L  K+KI+GD +K+FKEKKS+RE+FVCGACGQLGHMRTNK+CPKYGED E QVE TE EK   KS+SLE S Q Q + + KK+I KSATK+A+VE SEGEKSS   K LP+KFKC S DR  DK+  G T   D PV SD E G K   KV+KIIISN+ KP++ QVESHK  +VIR   +TD+   ESHK SIVI+PP+ ++RDQVE                     HKPS+VIRPP D D+DQP+KKIIIKRPKE I LDQ+SQ+G T  EYRKTKKIVELSSFEKH K E+  L E
Sbjct: 1117 LIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSAVDSDEIESDSEANSDLDSFAGDLENLLDAEECEDGEEGNCESKHDRTDGVRGLKMRRRPSQAQAEEEIEDEAAEAAELCRMLMDD-DEAERKKKKKTRPVGEEEGLALGSQLNFGFENGQKMKKNSAVVKQLVSKVQPDGSYSQKEKAFRDSKEVESFLPKRNISGKAKILKKNDAARMGVLHKKIKIMGDGIKMFKEKKSARESFVCGACGQLGHMRTNKNCPKYGEDLEAQVEITEPEKASVKSSSLEHSAQLQQRTLIKKIIPKSATKMALVETSEGEKSSLKAKNLPVKFKCGSADRLPDKVAPGTTHGPDQPVISDAETGNK-FVKVNKIIISNKMKPEDSQVESHKPSIVIRPPTETDKEHVESHKPSIVIRPPSEIDRDQVESHKPSNVTRPPTETDRDQVESHKPSIVIRPPVDTDRDQPRKKIIIKRPKE-ISLDQVSQDGSTGLEYRKTKKIVELSSFEKHKKPETKHLNE 1662          

HSP 2 Score: 239.58 bits (610), Expect = 1.850e-61
Identity = 124/154 (80.52%), Postives = 140/154 (90.91%), Query Frame = 1
Query: 1834 LEDYXXXXXXXXXXXXXXGAKRKPV-ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            LEDYRTRRNDRR PERDR  KR+PV ELG++GA+Y PPTKRRRGGEVGL+N+LE IV++LRD  EVSYLFLKPVSKKEAPDYL+I++ PMDLSTIR+KVR+MEYKN+E+FRHDVWQI YNAH YNDGRNPGIPPLADQLLELCDYLL E+  SL
Sbjct: 1748 LEDYRTRRNDRRIPERDRSTKRRPVVELGKFGADYGPPTKRRRGGEVGLSNVLESIVDSLRDRYEVSYLFLKPVSKKEAPDYLDIIRDPMDLSTIREKVRKMEYKNREDFRHDVWQITYNAHKYNDGRNPGIPPLADQLLELCDYLLSENDASL 1901          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: V4S1D5_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100041252mg PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.517e-139
Identity = 339/544 (62.32%), Postives = 403/544 (74.08%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQ-LKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCST-DRPSDKLTSGGTQSSDHPVTSDP-ENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDT---------------------DRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQ 1560
            +IAKQTRWHRIAMIRKLSSEQAASGV+VDPTTISKYARGQRMSFLQLQQQTR KCQEIWDRQ+QSLSA D +E  SDSE +     FAGDLENLLDAEEFEE E   +  K DK + VKGLKMRRRP + QAEEEIEDEAAEAAELCRLLMDD++ + KKKKKK KA  E  GL+   +   G+E ++R+KK +   K I  + Q NGS+  NE  +KD K+ ES I K ++SGK++ MKKN +   G   KVKI+ DN K+FKEKKSSRETFVCGACGQ GHMRTNK+CP+Y  DPETQ+E  +++K+ GKS SL+PS QSQ   + KKKLI+KSATKIA++EA E EKSS  TK +P+KFKCS+ D+  DK     TQSSD P TSD  E   KS  KV++I+ISN+ +P+E QVESHK  +VIR  VDT                     DR Q ESHK SI+I+P    +R+ VE HKPS+VIRPPADKD++ PQKKIIIKRPKE+IDLD++SQ+G    EYRKTKKIVELS+FEK  KQ
Sbjct:   11 MIAKQTRWHRIAMIRKLSSEQAASGVQVDPTTISKYARGQRMSFLQLQQQTRGKCQEIWDRQVQSLSAADDDEIGSDSEHSDLDS-FAGDLENLLDAEEFEEEESNYDT-KHDKVEGVKGLKMRRRPIQVQAEEEIEDEAAEAAELCRLLMDDDEAELKKKKKKTKAQVE-GGLSLA-KSISGLEIVERLKKPNKPAKHIAITVQPNGSHTANEQ-IKDPKEEESLIAKRNLSGKVQAMKKNSISPVG--KKVKIVVDNGKMFKEKKSSRETFVCGACGQHGHMRTNKNCPRYRADPETQLETADMDKSLGKSNSLDPSSQSQPKSLKKKKLISKSATKIALIEAPEDEKSSLKTKVVPVKFKCSSADKLPDKFPVASTQSSDQPSTSDVVETANKSVGKVNRIVISNKPRPEETQVESHKPSIVIRPPVDTVDKSQAESHKPSIIIRPPANTDREQVESHKPSILIRPVTTTDRELVEYHKPSIVIRPPADKDREPPQKKIIIKRPKEIIDLDRVSQDGSPQ-EYRKTKKIVELSNFEKREKQ 546          

HSP 2 Score: 240.736 bits (613), Expect = 1.657e-63
Identity = 122/154 (79.22%), Postives = 141/154 (91.56%), Query Frame = 1
Query: 1834 LEDYXXXXXXXXXXXXXXGAKRKP-VELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            L+DYR +RNDRR PERDRGAKRKP  ELG++ A+Y PPTKRRRGGEVGL+NILERIVETLR+NTE+SYLFLKPV+KKEAPDYL+I++ PMDLSTIR KVRRMEYK++E+FRHDVWQIA+NAH YNDGR+P IPPLADQLLELCDYL+ E  +SL
Sbjct:  638 LQDYRAKRNDRRMPERDRGAKRKPGAELGKHSADYGPPTKRRRGGEVGLSNILERIVETLRENTELSYLFLKPVAKKEAPDYLDIIERPMDLSTIRGKVRRMEYKDREDFRHDVWQIAFNAHKYNDGRHPAIPPLADQLLELCDYLIDEYHESL 791          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: B9HED4_POPTR (Ubiquitin family protein OS=Populus trichocarpa GN=POPTR_0007s03490g PE=4 SV=2)

HSP 1 Score: 457.988 bits (1177), Expect = 1.406e-134
Identity = 321/527 (60.91%), Postives = 401/527 (76.09%), Query Frame = 1
Query:    4 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVK-LFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDH-------PVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGK 1557
            IAKQTRWHRIAMIRKLSSEQA+ GVKVDPTTISKYARGQRMSFLQL QQTREKCQEIWDRQ+QSLSA+DG+E ESDSEANSDLDSFAG     L   E  EG+E N  +K DK D VKG+KMRRRP +AQAEEE EDEAAEAAELCRLLMDD D+ ++K+KKK + V  DA +T   +P   V+++   KK        +  TQ NGSY + +N ++D K++E+   KG +S K+K +KKNG  +T PL    I+ D +  +FKEKKS+RE FVCGACGQLGHM+TNK+CPKYG++PET  E  +LEK+  KSTS +    SQ K+ KKK+I+K++TKI   EA+EGEKSS   K+LP+KFKC ST++ SDK + G   +S+        PV+SD + G+++ +KVSKI I N+ KP+ +QVESHK  +VIR  +DT+RGQ+ESHK SIVI+PP  M+RD V+PHKPS+VIRPPA+KD+ + QKKI+IK+PKE+IDLDQ+SQ+G    E+RKTKKIVELSSFEK GK
Sbjct: 1125 IAKQTRWHRIAMIRKLSSEQASCGVKVDPTTISKYARGQRMSFLQLHQQTREKCQEIWDRQVQSLSALDGDEIESDSEANSDLDSFAG-DLENLLDAEEFEGDENNYESKHDKGDGVKGIKMRRRPSQAQAEEEFEDEAAEAAELCRLLMDD-DEAEQKRKKKTRNVGVDAVVT-PTKPNF-VDNVHWGKK--------MNKTQPNGSYALKQNNIRDLKELETLSIKGKMSEKVKTVKKNGAFNTPPLKAKVIMADGLNHIFKEKKSARERFVCGACGQLGHMKTNKNCPKYGKEPETPSETIDLEKSSRKSTSQDLLNVSQHKLQKKKMISKNSTKI---EAAEGEKSSL-AKSLPVKFKCGSTEKFSDKPSDGAADTSNQPTTSNVRPVSSDIDTGSRATSKVSKIKIFNKVKPENVQVESHKPSIVIRPPMDTERGQSESHKPSIVIRPPTYMDRDHVDPHKPSIVIRPPAEKDRKKTQKKIVIKQPKEIIDLDQVSQDGSPGYEHRKTKKIVELSSFEKPGK 1635          

HSP 2 Score: 232.261 bits (591), Expect = 3.697e-59
Identity = 117/154 (75.97%), Postives = 135/154 (87.66%), Query Frame = 1
Query: 1834 LEDYXXXXXXXXXXXXXXGAKRKPV-ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            L+D+R  RN+RR PERDRGAKR+PV ++G YGA+Y P TKRRR GEVGLANILE IV+ L+D  EVSYLFLKPV KKEAPDYL+I+K PMDLSTI+DK R+MEYKN+ EFRHD+WQIAYNAH+YNDGRNPGIPPLADQLLE+CD+LL E  DSL
Sbjct: 1731 LDDFRADRNERRMPERDRGAKRRPVVDVGNYGADYTPATKRRRVGEVGLANILEGIVDALKDRLEVSYLFLKPVLKKEAPDYLHIIKRPMDLSTIKDKARKMEYKNRNEFRHDMWQIAYNAHLYNDGRNPGIPPLADQLLEICDFLLMEKQDSL 1884          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: B9IJA8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0017s07490g PE=4 SV=2)

HSP 1 Score: 454.136 bits (1167), Expect = 1.874e-133
Identity = 317/530 (59.81%), Postives = 391/530 (73.77%), Query Frame = 1
Query:    4 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPR--IGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKN-GMPSTGPLTKVKILGDNVK-LFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDH-------PVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGK 1557
            IAKQTRWHRIAMIRKLSSEQA+ GVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSA+DG+E ESDSEANSDLDSFAG     L   E  EG+E N  +K DK D VKG+KMRRRP +AQAEEE EDEAAEAAELCRLLMDD++       +K K   +  GL   L P+    V+++ R KK        +  TQ +GSY   EN ++D+K++E+   KG  S K+  +KKN G+ +T PL    I+ D +  +FKEKKS+RE FVCGACGQLGHM+TNK+CPKYG++PET VE T+LEK   KSTS +    SQ K+ KK++++KSATK   VE SEGEKSS   K+LP+KFKC ST++ SDK   G    SD        PV+SD + G++S AKV+KI I N+AKP+ +QVESHK  +VIR  +D +R Q ESHK SIVI+PP   +R+ V+PHKPS+VIRPPA+KD+++ QKKI+IK+ KE+ID D++SQ+G T  E+RKTKKI ELSSFEKHGK
Sbjct: 1055 IAKQTRWHRIAMIRKLSSEQASCGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSALDGDEIESDSEANSDLDSFAG-DLENLLDAEEFEGDESNYESKHDKGDCVKGIKMRRRPSQAQAEEEFEDEAAEAAELCRLLMDDDE-----AGQKKKKKIKTGGLNAVLAPKKPSFVDNVHRGKK--------MNKTQPSGSYTPKENSIRDSKEVETLFMKGKASEKVNTVKKNVGISNTPPLKAKVIMADGLNHIFKEKKSAREKFVCGACGQLGHMKTNKNCPKYGKEPETPVETTDLEKASRKSTSQDLLNVSQHKLQKKRMVSKSATK---VEVSEGEKSSL-AKSLPVKFKCGSTEKFSDKPADGAADHSDQPTTSDVRPVSSDIDTGSRSTAKVNKIKIFNKAKPENIQVESHKPSIVIRPPMDIERSQIESHKPSIVIRPPTYTDRNHVDPHKPSIVIRPPAEKDREKTQKKIVIKQSKEIIDPDRVSQDGRTGREHRKTKKIAELSSFEKHGK 1566          

HSP 2 Score: 234.572 bits (597), Expect = 6.589e-60
Identity = 119/154 (77.27%), Postives = 134/154 (87.01%), Query Frame = 1
Query: 1834 LEDYXXXXXXXXXXXXXXGAKRKPV-ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            L+DYR  RN RR PERDRGAKR+PV ++G YGA+Y P TKRRR GEVGLANILE IV+ L+D  EVSYLFLKPV KKEAPDYL+I+K PMDLSTIRDK R+MEYK++ EFRHD+WQIAYNAH+YNDGRNPGIPPLADQLLELCDYLL E  +SL
Sbjct: 1660 LDDYRGARNGRRMPERDRGAKRRPVVDVGTYGADYTPATKRRRVGEVGLANILEGIVDALKDRVEVSYLFLKPVPKKEAPDYLDIIKRPMDLSTIRDKARKMEYKDRNEFRHDMWQIAYNAHVYNDGRNPGIPPLADQLLELCDYLLMEKQESL 1813          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: W9QXK0_9ROSA (Transcription initiation factor TFIID subunit 1-A OS=Morus notabilis GN=L484_011395 PE=4 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 1.356e-131
Identity = 338/548 (61.68%), Postives = 396/548 (72.26%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVX-XXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMD---------------------DEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLT--KVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESL 1569
            VIAKQTRWHRIAMIRKLSSEQA SGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSA +  E      E NSDLDSFAGDLENLLDAEE EE  EGN+++K DKAD VKGLKMRRRP  AQAEEEIEDEAAEAAELCRLLMD                      +D+ ++KKKKK +++ E AGLT G +  +G +S  RV       KQI  + Q  GSY   +N   +TK +E+ + K +  GK+K  KKN       LT  K+KI  D    FKEKKS+R+ FVCGACGQLGHMRTNK+CPKYGE  +T VE  +LEK PGKST+L  SG S +K + KKLI KSATKIA+VEASEGE SS +TK +PLKFKC STD   +K T G TQ +D P+TSD E G KS  KV+KIIISN+ K +++ V SHK P+VIR   DTD+GQ E  K +I I+PPAN ERD+VE HK  +  RPP +++++Q  KKIIIKRPKEVIDLDQ SQ GGT  E+RKTK+IVELSSFE H K E++
Sbjct: 1206 VIAKQTRWHRIAMIRKLSSEQAESGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSAFEGDENESDSEENNSDLDSFAGDLENLLDAEECEEEVEGNHDSKYDKADGVKGLKMRRRPSLAQAEEEIEDEAAEAAELCRLLMDGKVHLWKEPSAFLHADHSSFFTDDETERKKKKKERSMGEGAGLTPGSRSNLGFQSADRV-------KQITIANQPAGSYASIDNTAVETKVVEN-LLKKNKPGKMKAKKKNDDIVDMSLTNKKIKIAVDGT--FKEKKSARDNFVCGACGQLGHMRTNKNCPKYGE-LDTHVETPDLEKVPGKSTTLNASGPSPIKTVTKKLIPKSATKIALVEASEGENSSPSTKVVPLKFKCSSTDNVPEKFTLGLTQITDQPITSDAETG-KSTVKVNKIIISNKQKTEDVHVGSHKPPIVIRPPTDTDKGQGELQKPTIFIRPPANTERDRVESHK--ISKRPPKEREREQSHKKIIIKRPKEVIDLDQFSQHGGTGIEHRKTKRIVELSSFEMHRKPENI 1739          

HSP 2 Score: 226.868 bits (577), Expect = 1.865e-57
Identity = 103/135 (76.30%), Postives = 121/135 (89.63%), Query Frame = 1
Query: 1891 AKRKP-VELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            AKR+P VEL RYG +    TKRRRGGEVGLANILE IVETL+D  EVSYLFLKPVSKKEAPDY++I+  PMDLSTI++KVR+MEY+++E+FRHDVWQIA+NAH YNDGRNPGIPPLADQLLELCDY+L+E+ +SL
Sbjct: 1847 AKRRPIVELARYGTDNAATTKRRRGGEVGLANILEHIVETLKDRYEVSYLFLKPVSKKEAPDYVDIIDRPMDLSTIKEKVRKMEYRSREQFRHDVWQIAFNAHKYNDGRNPGIPPLADQLLELCDYILNENDESL 1981          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: A0A067LA06_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_24953 PE=4 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.168e-130
Identity = 328/540 (60.74%), Postives = 388/540 (71.85%), Query Frame = 1
Query:    4 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIG---VESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTK--DIESRIFKGSVSGKLKGMKKNGMPSTGPL---TKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDHPVTSDP-------ENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRL 1575
            IAKQTRWHRIA IRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSAVDG+ENESDSEANSDLDSFAG     L   E  EG+E N  +K DKAD +KGLKMR R  +AQAEEEIEDEAAEAAELCRLLMDD++ ++KKKKK         G+  GL PR     V + +R+KKT+ +          N S    E+ ++D+K  ++E+   K  +S KLK +KKNG   +      TKVKI G+  K FKEKK SRETFVCGACGQLGHMRTNK+CPKYGE+ E QVE  +LEK  GKS SL+PS +S  K+ KKK + K   K   V+ SE EKSS   K LP+KFKC ST++ SDK   G T+SSD PVTSD        E G+K  AKVSKI ISN+AK +++QVE HK  +VIR  +DTDR Q ESHK SIVI+PP+N ERD VE HKPS+VIRPPA KD++Q  KKI+IK+PKE++DLDQ+SQ+G T  E+RK K+I ELS  E   K + L  
Sbjct: 1137 IAKQTRWHRIATIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSAVDGDENESDSEANSDLDSFAG-DLENLLDAEECEGDESNYESKHDKADGMKGLKMRGRASQAQAEEEIEDEAAEAAELCRLLMDDDEAEQKKKKKTKI-----PGVGAGLAPRSKPNFVANAERIKKTNKV--------HPNDSCLPKESSIRDSKEVNVETLFAKRKMSEKLKAIKKNGTSDSTISTIKTKVKISGEGPKTFKEKKPSRETFVCGACGQLGHMRTNKNCPKYGEESEAQVETADLEKVSGKSNSLDPSSKSMQKLQKKKSMPKGTVK---VQPSESEKSSLKAKPLPVKFKCGSTEKLSDKPADGATKSSDWPVTSDARPDSSDVETGSKPIAKVSKIKISNKAKTEDVQVELHKPSIVIRPPMDTDRSQIESHKPSIVIRPPSNTERDHVESHKPSIVIRPPAVKDREQAHKKIVIKQPKEIVDLDQVSQDGSTGFEFRKIKRIAELSGIENRRKSQILHF 1659          

HSP 2 Score: 247.669 bits (631), Expect = 5.975e-64
Identity = 112/136 (82.35%), Postives = 125/136 (91.91%), Query Frame = 1
Query: 1888 GAKRKPV-ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            GAKR+PV ELGR+GAEY P TKRRRGGEVGLANILE IV+TL+D  ++SYLFLKPVSKKEAPDYL+I+KHPMDLSTIRDKVR+MEYK++E+FRHDVWQI YNAH+YND RNPGIPPLADQLLELCDYLL E S SL
Sbjct: 1762 GAKRRPVVELGRFGAEYTPATKRRRGGEVGLANILEHIVDTLKDKLDISYLFLKPVSKKEAPDYLDIIKHPMDLSTIRDKVRKMEYKHREDFRHDVWQITYNAHLYNDRRNPGIPPLADQLLELCDYLLKEQSHSL 1897          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Match: B9S9F7_RICCO (Transcription initiation factor tfiid, putative OS=Ricinus communis GN=RCOM_0884950 PE=4 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 1.800e-129
Identity = 327/531 (61.58%), Postives = 386/531 (72.69%), Query Frame = 1
Query:    4 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIG---VESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGM--PSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-STDRPSDKLTSGGTQSSDHPVTSDP-------ENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGK 1557
            IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQ+QSLSAVDG+E ESDSEANSDLDSFAG     L   E  EG+E N  +K DKAD VKG+KMRR P +AQAEEEIEDEAAEAAELCRLLMDD++ +     +K K  T+ AGL  GL P +    V S + +K+              NGS+   E+ +KD+K++E+   K   S K+K +KKNG    ST PLTK +I       FKEKKSSRE FVCGACGQLGHMRTNK+CPKYGE+PE QVE T+LEK+ GKS SL+P  +SQ K+ KKK + K+A K   VE  EGEKSS   K LP+KF C ST++ SDK   G  QSS+ P+TSD        E G+   AK+SKI ISN+AKP+++Q++ HK  +VIR  +DTD+GQ E HK SIVI+PPAN ERD VE HKPS+VIRPPA KD+ QP KK++I +PKEVIDLDQ+SQ+G T  EYRK KKI ELS  +K  K
Sbjct: 1122 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQVQSLSAVDGDELESDSEANSDLDSFAG-DLENLLDAEECEGDESNYESKQDKADGVKGIKMRRHPSQAQAEEEIEDEAAEAAELCRLLMDDDEAE-----QKKKKKTKTAGLVAGLLPGLKSNFVNSTEHIKQKD--------KGHPNGSFVPKESSIKDSKEVEALFIKKKKSEKVKALKKNGFQDSSTPPLTKNQI-------FKEKKSSREKFVCGACGQLGHMRTNKNCPKYGEEPEAQVEITDLEKSSGKSNSLDPLFKSQQKLQKKKSMLKTAAK---VEDPEGEKSSLKAKLLPVKFVCSSTEKNSDKPADGAAQSSERPITSDVRPDSSEMETGSMPVAKISKIKISNKAKPEDVQMDVHKPAIVIRPPMDTDKGQNEYHKPSIVIRPPANTERDHVESHKPSIVIRPPAVKDRGQPHKKLVIIKPKEVIDLDQVSQDGSTGLEYRKIKKIAELSGVDKQRK 1628          

HSP 2 Score: 226.868 bits (577), Expect = 1.858e-57
Identity = 105/136 (77.21%), Postives = 119/136 (87.50%), Query Frame = 1
Query: 1888 GAKRKP-VELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            GAKR+  VEL +YG E+   TKRRRGGEVGLANILE +V+ LR   EVSYLFLKPV+KKEAPDYL+I+K PMDLSTIRDKVR+MEYK++EEFRHDVWQIAYNAH+YND RNPGIPPLADQLLE+CDYLL E + SL
Sbjct: 1738 GAKRRSIVELSKYGTEHASATKRRRGGEVGLANILEGVVDALRGRLEVSYLFLKPVTKKEAPDYLDIIKRPMDLSTIRDKVRKMEYKHREEFRHDVWQIAYNAHLYNDRRNPGIPPLADQLLEICDYLLAEQNSSL 1873          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_ARATH (Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.476e-102
Identity = 278/551 (50.45%), Postives = 363/551 (65.88%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKK-KLITKSATKIAVVEASEGEKSSTNTKALPLKFKCS--TDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSI---------------------VIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLME 1581
            +IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTI KYARGQRMSFLQ+QQQ REKCQEIWDRQ+ SLSA DG+ENES++EANSDLDSFAG     L   E     E +N +K DK D VKGLKMRRRP + + +EEIEDEA E AELCRLLM DED  +KKKKKK K V E  G     +P I ++S + V+K + + K+ + + Q + S+ +NE+ +KD ++++S I     + K K +K+N   S G L KVKIL +N+K+FKEKKS+RE FVCGACGQ GHMRTNKHCP+Y E+ E+Q E  +++K+ GK +S EPSG  +LK +K  K   KSA K +V EA +G+K S+ T  LPLKF+        SDK  S    SS+  V SD + G KS +K+SK+ IS++AKP E + ES +    +      +RG++ESHK S+                     + +P  +M+ DQ E  +P +VI      +++QPQKK++IKR KE+ D D  S E     E RKTK++ EL+ F+   +Q+S RL E
Sbjct: 1134 IIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTIGKYARGQRMSFLQMQQQAREKCQEIWDRQLLSLSAFDGDENESENEANSDLDSFAG-DLENLLDAEEGGEGEESNISKNDKLDGVKGLKMRRRPSQVETDEEIEDEATEYAELCRLLMQDED--QKKKKKKMKGVGEGMGSYPPPRPNIALQSGEPVRKANAMDKKPI-AIQPDASFLVNESTIKDNRNVDSII----KTPKGKQVKENSN-SLGQLKKVKILNENLKVFKEKKSARENFVCGACGQHGHMRTNKHCPRYRENTESQPEGIDMDKSAGKPSSSEPSGLPKLKPIKNSKAAPKSAMKTSVDEALKGDKLSSKTGGLPLKFRYGIPAGDLSDKPVSEAPGSSEQAVVSDIDTGIKSTSKISKLKISSKAKPKESKGESERRSHSLMPTFSRERGESESHKPSVSGQPLSSTERNQAASSRHTISIPRPSLSMDTDQAESRRPHLVI--RPPTEREQPQKKLVIKRSKEMNDHDMSSLEESPRFESRKTKRMAELAGFQ---RQQSFRLSE 1670          

HSP 2 Score: 215.312 bits (547), Expect = 1.084e-55
Identity = 98/128 (76.56%), Postives = 112/128 (87.50%), Query Frame = 1
Query: 1909 ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +  R GAEY P  KRR+ GEVGLANILERIV+TLR   EVS LFLKPVSKKEAPDYL+IV++PMDLSTIRDKVR++EY+N+E+FRHDVWQI YNAH+YNDGRNPGIPPLADQLLE+CDYLL +  D L
Sbjct: 1781 DFERDGAEYAPQPKRRKKGEVGLANILERIVDTLRLKEEVSRLFLKPVSKKEAPDYLDIVENPMDLSTIRDKVRKIEYRNREQFRHDVWQIKYNAHLYNDGRNPGIPPLADQLLEICDYLLDDYEDQL 1908          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1B_ARATH (Transcription initiation factor TFIID subunit 1b OS=Arabidopsis thaliana GN=TAF1B PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.127e-61
Identity = 236/550 (42.91%), Postives = 319/550 (58.00%), Query Frame = 1
Query:    1 VIAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPM-NENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVKILGDNVKLFKEKKSSRETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMM-KKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKCSTDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSI---------------------VIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQESLRLME 1581
            +IAKQT+ HR AMIRK+SSEQAASG KV PTT+  ++R QRMSFLQLQQQ RE C EIWDRQ  SLSA D + NES++EANSDLDSF GDLE+LLDAE+  EGEE N +   +K D VKGLKMRR P + + +EEIEDEAAE  ELCRLLM DE+D+KK          +D G   G  P        R      I K+ + +T+ + S+ + NE+ VK TK+++    K   S K K +K+ G P        KIL +N K+F  KK++R  FVCGACGQ GHM+TNKHCPKY  + E+Q E+ +++K+ GK +S + SG+  L  +  KK   KSATKI+V EA++   S++ T                        SSD    S+ ++G K  ++  K+ IS++AKP   +VES      +      +RG++E H  S+                     V +P  ++++DQ E  +P  VI       K+  QKK++IKR KE+ D D  S E     E RKTK++ EL+ F+   +Q+ LRL E
Sbjct: 1040 IIAKQTQRHRTAMIRKISSEQAASGGKVGPTTVGMFSRSQRMSFLQLQQQAREMCHEIWDRQRLSLSACDDDGNESENEANSDLDSFVGDLEDLLDAEDGGEGEESNKSMN-EKLDGVKGLKMRRWPSQVEKDEEIEDEAAEYVELCRLLMQDENDKKK-------KKLKDVGEGIGSFPP------PRSNFEPFIDKKYI-ATEPDASFLIVNESTVKHTKNVDKATSK---SPKDKQVKEIGTPIC---QMKKILKENQKVFMGKKTARANFVCGACGQHGHMKTNKHCPKYRRNTESQPESMDMKKSTGKPSSSDLSGEVWLTPIDNKKPAPKSATKISVNEATKVGDSTSKTPG----------------------SSDVAAVSEIDSGTKLTSR--KLKISSKAKPKASKVESDSPFHSLMPAYSRERGESELHNPSVSGQLLPSTETDQAASSRYTTSVPQPSLSIDKDQAESCRPHRVI--WPPTGKEHSQKKLVIKRLKEITDHDSGSLEETPQFESRKTKRMAELADFQ---RQQRLRLSE 1539          

HSP 2 Score: 185.652 bits (470), Expect = 2.908e-46
Identity = 88/129 (68.22%), Postives = 102/129 (79.07%), Query Frame = 1
Query: 1909 ELGRYGAEYVPPTKRRRGGEVGLANILERIVETLR-DNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +  R   EY P  KRR+ G+VGLANILE IV+TLR     VSYLFLKPV+KKEAP+YL IVK PMDLSTIRDKVRRMEY+++++FRHDVWQI +NAH+YNDGRN  IPPLAD+LL  CD LL E  D L
Sbjct: 1643 DFERNRTEYAPQPKRRKKGQVGLANILESIVDTLRVKEVNVSYLFLKPVTKKEAPNYLEIVKCPMDLSTIRDKVRRMEYRDRQQFRHDVWQIKFNAHLYNDGRNLSIPPLADELLVKCDRLLDEYRDEL 1771          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_ORYSJ (Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 6.674e-59
Identity = 218/530 (41.13%), Postives = 303/530 (57.17%), Query Frame = 1
Query:    4 IAKQTRWHRIAMIRKLSSEQAASGVKVDPTTISKYARGQRMSFLQLQQQTREKCQEIWDRQIQSLSAVXXXXXXXXXXXXXXXXXFAGXXXXXXXXXXXXXXXXXXXXXKVDKADAVKGLKMRRRPYKXXXXXXXXXXXXXXXXLCRLLMDDEDDQXXXXXXXXXAVTEDAGLTFGLQPRIGVESLQRVKKTSIIPKQIVRSTQSNGSYPMNENFVKDTKDIESRIFKGSVSGKLKGMKKNGMPSTGPLTKVK---ILGDNVKLFKEKKSSR--ETFVCGACGQLGHMRTNKHCPKYGEDPETQVEATELEKTPGKSTSLEPSGQSQLKMMKKKLITKSATKIAVVEASEGEKSSTNTKALPLKFKC-----STDRPSDKLTSGGTQSSDHPVTSDPENGAKSAAKVSKIIISNRAKPDEMQVESHKLPVVIRHQVDTDRGQAESHKKSIVIKPPANMERDQVEPHKPSVVIXXXXXXXXXXXXXXXXXXXXXEVIDLDQLSQEGGTYPEYRKTKKIVELSSFEKHGKQE 1563
            I K TRWHRIAM+RKLSSEQAASGV +D   +SK+ARGQRMSFLQLQQQT+EKCQEIWDRQIQSLSA+DG EN SD+EANSDLDSFAGDLENLLDAEEF++ + GN + + DK D ++GLKMRR   ++Q  EEI+D+ AEAA + +LL + + D K+KK+              G + + G               Q+++S+   G+    E+  ++ K++E+   +GS+  KL+   K G  +   +  VK   I G +   FKEK+     +T VCGACGQLGHMRTNK CPKYGEDPET    +E++    +S   +    +Q+K   K+L+ K +++      +EG +S    K +P+KFKC     S DR    ++   +  SD  +       +KS  KV+KI ISN+ K D+                       ++ K S+VI+PPA +E+D   P K  ++                   +  +V+   Q   E  +  E RKT+KIVELSSFEK  +++
Sbjct: 1110 IDKLTRWHRIAMVRKLSSEQAASGVTMDEIPVSKFARGQRMSFLQLQQQTKEKCQEIWDRQIQSLSAMDGNENGSDTEANSDLDSFAGDLENLLDAEEFDDEDVGNTDIRSDKMDGMRGLKMRRCHTQSQINEEIQDDVAEAALVEKLLEESDSDMKRKKQPVETTNYSTPMYNQGNKMKQGKAG------------QMIKSSVYAGALTPKESIPREAKEVEN-FAEGSLPSKLR--TKTGFDANDDIILVKRKNIPGKDG--FKEKRQGARGDTLVCGACGQLGHMRTNKLCPKYGEDPET----SEMDVNSIRSHPPDIVSNAQIKTSNKRLVAKVSSEAF---ETEGPESIEKAKPVPVKFKCGAPEKSLDR---NMSISASLVSDKRMMD--ATDSKSTGKVNKIKISNKIKYDDY--------------------PPDTPKPSVVIRPPAEVEKDL--PRKKIII-------------------KQPKVLGDQQRPTELRSGQEPRKTRKIVELSSFEKRDRED 1569          

HSP 2 Score: 183.341 bits (464), Expect = 1.329e-45
Identity = 87/133 (65.41%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1894 KRKPVELGRYGAEYVPPTKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +R P ++     EY PP KR RGGEV L+NILE+IV+ LR     S+LF KPV+KKEAPDY +I++ PMDL TIRDKVR+MEYKN+E+FRHDV QIA NAH YN  R+P IPPLAD+LLELCDYLL ES+D L
Sbjct: 1674 RRTPADM----TEYTPPAKRHRGGEVELSNILEKIVDHLR-TMSCSFLFRKPVTKKEAPDYFDIIERPMDLGTIRDKVRKMEYKNREDFRHDVAQIALNAHTYNLNRHPHIPPLADELLELCDYLLEESADVL 1801          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_DICDI (Transcription initiation factor TFIID subunit 1 OS=Dictyostelium discoideum GN=taf1 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.478e-12
Identity = 41/104 (39.42%), Postives = 63/104 (60.58%), Query Frame = 1
Query: 1960 GGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLL 2271
            G +V L+NI ERI++ LR N E    F   V+ K APDY  ++K+P+DL+T+RD+ R  EYK++ +F   +  +  N   YN+ R   + P+A++LL     LL
Sbjct: 2112 GADVELSNIFERILDKLRTNDEF-IAFRHKVTPKLAPDYHKVIKNPIDLTTMRDRNRHWEYKSKNQFIDAIKLMVANCFEYNEKRFSHLLPIAEKLLTSTLQLL 2214          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_MESAU (Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.314e-12
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query: 1948 KRRRGGEVGLANILERIVETLRD--NTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +RR    V L++ILE I+  +RD  NT   Y F  PV+ K   DY  I+  PMDL T+R+ VR+  Y ++EEFR  +  I  N+  YN G    +  ++  +L+LCD  L E  D L
Sbjct: 1371 RRRTDPMVTLSSILESIINDMRDLPNT---YPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYN-GPKHSLTQISQSMLDLCDEKLKEKEDKL 1483          

HSP 2 Score: 57.7658 bits (138), Expect = 6.272e-7
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 1966 EVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +V  + IL+ IV         S+ F  PV+KK  PDY  ++  PMDL TIR  + + +Y+++E F  DV  I  N+  YN G        A +++ +C   L E  + L
Sbjct: 1499 QVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVSPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYN-GSESQYTKTAQEIVNVCYQTLTEYDEHL 1606          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_MOUSE (Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 6.331e-12
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query: 1948 KRRRGGEVGLANILERIVETLRD--NTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +RR    V L++ILE I+  +RD  NT   Y F  PV+ K   DY  I+  PMDL T+R+ VR+  Y ++EEFR  +  I  N+  YN G    +  ++  +L+LCD  L E  D L
Sbjct: 1397 RRRTDPMVTLSSILESIINDMRDLPNT---YPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYN-GPKHSLTQISQSMLDLCDEKLKEKEDKL 1509          

HSP 2 Score: 57.7658 bits (138), Expect = 6.231e-7
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 1966 EVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +V  + IL+ IV         S+ F  PV+KK  PDY  ++  PMDL TIR  + + +Y+++E F  DV  I  N+  YN G        A +++ +C   L E  + L
Sbjct: 1525 QVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVSPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYN-GPESQYTKTAQEIVNVCHQTLTEYDEHL 1632          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_HUMAN (Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 6.481e-12
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query: 1948 KRRRGGEVGLANILERIVETLRD--NTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +RR    V L++ILE I+  +RD  NT   Y F  PV+ K   DY  I+  PMDL T+R+ VR+  Y ++EEFR  +  I  N+  YN G    +  ++  +L+LCD  L E  D L
Sbjct: 1376 RRRTDPMVTLSSILESIINDMRDLPNT---YPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYN-GPKHSLTQISQSMLDLCDEKLKEKEDKL 1488          

HSP 2 Score: 57.3806 bits (137), Expect = 7.307e-7
Identity = 36/109 (33.03%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 1966 EVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +V  + IL+ IV         S+ F  PV+KK  PDY  ++ +PMDL TIR  + + +Y+++E F  DV  I  N+  YN G        A +++ +C   L E  + L
Sbjct: 1504 QVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYN-GPESQYTKTAQEIVNVCYQTLTEYDEHL 1611          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1L_HUMAN (Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.429e-11
Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 1
Query: 1948 KRRRGGEVGLANILERIVETLRD--NTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
            +RR    V L++ILE I+  +RD  NT   + F  PV+ K   DY  I+  PMDL T+R+ VR+  Y ++EEFR  +  I  N+  YN G    +  ++  +L+LCD  L E  D L
Sbjct: 1395 RRRTDPMVTLSSILESIINDMRDLPNT---HPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKCLYPSREEFREHLELIVKNSATYN-GPKHSLTQISQSMLDLCDEKLKEKEDKL 1507          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: TAF1_DROME (Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 7.844e-11
Identity = 47/116 (40.52%), Postives = 63/116 (54.31%), Query Frame = 1
Query: 1945 TKRRRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYNDGRNPGIPPLADQLLELCDYLLHESSDSL 2292
             +RR    V L++ILE I   LR   +VS  FL PVS K+ PDY  +V  PMDL T+R+ +R+  Y ++E F  D+ QI  N+ IYN G        A ++   C  LL E  D L
Sbjct: 1465 NRRRTDPVVVLSSILEIIHNELRSMPDVS-PFLFPVSAKKVPDYYRVVTKPMDLQTMREYIRQRRYTSREMFLEDLKQIVDNSLIYN-GPQSAYTLAAQRMFSSCFELLAEREDKL 1578          
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Match: SPT7_SCHPO (Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 8.022e-11
Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 1
Query: 1954 RRGGEVGLANILERIVETLRDNTEVSYLFLKPVSKKEAPDYLNIVKHPMDLSTIRDKVRRMEYKNQEEFRHDVWQIAYNAHIYN 2205
            +R G+  L    E++V  LR  TE S  FL  VSK++APDY  ++K PMDL TI   ++ + Y +++EF HD+  I  N  +YN
Sbjct:  309 QRIGQEELYEAAEKVVLELRSYTEHSLAFLTKVSKRDAPDYYTVIKEPMDLGTILRNLKNLHYNSKKEFVHDLMLIWSNCFLYN 392          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0NPM1_GOSAR0.000e+099.74Transcription initiation factor TFIID subunit 1-A-... [more]
A0A0D2UTN8_GOSRA0.000e+098.69Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061ER02_THECC0.000e+084.71Histone acetyltransferase, putative OS=Theobroma c... [more]
F6H596_VITVI8.169e-15165.03Putative uncharacterized protein OS=Vitis vinifera... [more]
V4S1D5_9ROSI1.517e-13962.32Uncharacterized protein (Fragment) OS=Citrus cleme... [more]
B9HED4_POPTR1.406e-13460.91Ubiquitin family protein OS=Populus trichocarpa GN... [more]
B9IJA8_POPTR1.874e-13359.81Uncharacterized protein OS=Populus trichocarpa GN=... [more]
W9QXK0_9ROSA1.356e-13161.68Transcription initiation factor TFIID subunit 1-A ... [more]
A0A067LA06_JATCU1.168e-13060.74Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9S9F7_RICCO1.800e-12961.58Transcription initiation factor tfiid, putative OS... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0004526 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
TAF1_ARATH1.476e-10250.45Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1B_ARATH1.127e-6142.91Transcription initiation factor TFIID subunit 1b O... [more]
TAF1_ORYSJ6.674e-5941.13Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1_DICDI4.478e-1239.42Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1_MESAU6.314e-1239.32Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1_MOUSE6.331e-1239.32Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1_HUMAN6.481e-1239.32Transcription initiation factor TFIID subunit 1 OS... [more]
TAF1L_HUMAN1.429e-1138.46Transcription initiation factor TFIID subunit 1-li... [more]
TAF1_DROME7.844e-1140.52Transcription initiation factor TFIID subunit 1 OS... [more]
SPT7_SCHPO8.022e-1141.67Transcriptional activator spt7 OS=Schizosaccharomy... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 139..159
NoneNo IPR availableCOILSCoilCoilcoord: 117..137
NoneNo IPR availableCOILSCoilCoilcoord: 540..598
NoneNo IPR availablePFAMPF15288zf-CCHC_6coord: 263..281
e-value: 6.4E-5
score: 22.6
NoneNo IPR availablePANTHERPTHR13900TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 1..330
NoneNo IPR availablePANTHERPTHR13900TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 412..594
NoneNo IPR availablePANTHERPTHR13900:SF0TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 1-RELATEDcoord: 624..759
NoneNo IPR availablePANTHERPTHR13900:SF0TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 1-RELATEDcoord: 1..330
NoneNo IPR availablePANTHERPTHR13900TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 624..759
NoneNo IPR availablePANTHERPTHR13900:SF0TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 1-RELATEDcoord: 412..594
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 693..711
score: 26.43
coord: 663..676
score: 31.68
coord: 711..730
score: 26.96
coord: 677..693
score: 54.35
IPR001487BromodomainSMARTSM00297bromo_6coord: 640..750
e-value: 5.8E-23
score: 92.3
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 651..726
e-value: 1.2E-18
score: 66.8
IPR001487BromodomainGENE3D1.20.920.10coord: 637..752
e-value: 6.5E-26
score: 89.9
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 660..730
score: 18.571
IPR001487BromodomainSUPERFAMILY47370Bromodomaincoord: 632..751
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 665..722

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0004526 ID=g.arboreum_cottongen_reftransV1_0004526|Name=g.arboreum_cottongen_reftransV1_0004526|organism=Gossypium arboreum|type=contig|length=3025bp
GTGATTGCAAAACAAACTAGGTGGCATCGTATTGCAATGATACGCAAGCT
CTCAAGTGAGCAAGCTGCATCAGGAGTCAAGGTTGATCCAACAACTATAA
GCAAGTATGCACGGGGACAGCGAATGTCCTTTCTTCAGTTACAACAGCAG
ACCAGAGAAAAATGTCAGGAAATATGGGATCGCCAAATTCAGTCTCTTTC
AGCTGTTGATGGTGAAGAAAATGAAAGTGATTCTGAGGCAAATAGTGATC
TTGATTCCTTTGCTGGCGACCTAGAAAATTTGCTTGATGCAGAGGAATTC
GAAGAAGGGGAAGAAGGTAACAACAATAACAAGGTTGACAAAGCAGATGC
TGTTAAGGGGCTCAAGATGAGAAGACGTCCCTATAAGGCTCAGGCAGAAG
AAGAAATTGAAGATGAGGCTGCTGAAGCTGCTGAATTATGTCGTTTACTC
ATGGATGATGAGGATGACCAAAAGAAGAAAAAAAAGAAGAAAAACAAAGC
TGTTACAGAAGATGCTGGGTTGACTTTCGGCTTACAACCACGCATTGGTG
TTGAGAGTTTACAACGTGTTAAGAAAACAAGCATAATTCCCAAGCAAATT
GTTCGTTCTACTCAATCTAATGGGTCATATCCTATGAATGAGAATTTTGT
CAAGGATACAAAGGATATTGAAAGTAGAATTTTTAAAGGAAGCGTGTCTG
GAAAGTTGAAAGGAATGAAAAAAAATGGTATGCCAAGCACAGGTCCATTA
ACTAAAGTCAAAATATTGGGAGACAATGTCAAGTTGTTCAAGGAGAAGAA
ATCATCGAGAGAAACTTTTGTCTGTGGAGCTTGTGGTCAGCTTGGACACA
TGAGGACCAACAAGCACTGCCCCAAGTATGGAGAAGATCCAGAAACGCAG
GTTGAAGCTACTGAGTTGGAAAAAACTCCTGGGAAATCAACTTCGCTAGA
ACCCTCTGGTCAGTCCCAATTGAAGATGATGAAAAAGAAGCTCATAACTA
AAAGTGCGACAAAGATAGCAGTTGTAGAAGCTTCGGAGGGTGAAAAATCT
AGTACAAACACAAAAGCTCTTCCGTTGAAATTCAAATGCTCTACTGATAG
GCCGTCTGATAAACTTACTTCTGGAGGGACACAAAGTTCTGACCATCCAG
TCACTTCTGATCCAGAAAATGGAGCCAAGTCTGCTGCCAAGGTTAGTAAA
ATAATTATTTCCAACAGGGCTAAGCCTGATGAAATGCAGGTTGAGTCTCA
TAAGCTGCCTGTTGTTATACGGCATCAAGTGGATACCGATAGAGGCCAAG
CTGAATCCCATAAGAAATCTATTGTTATAAAGCCACCAGCAAACATGGAG
AGGGACCAAGTTGAACCTCATAAACCCTCTGTTGTCATACGCCCACCAGC
AGATAAAGATAAGGATCAACCTCAAAAAAAAATTATAATCAAGCGACCGA
AGGAAGTTATTGATTTGGATCAACTTAGTCAAGAGGGAGGCACTTATCCT
GAATACAGGAAAACAAAAAAAATAGTTGAATTGTCAAGCTTTGAGAAGCA
TGGGAAGCAGGAAAGCTTGCGATTAATGGAGCCAAAAGCAAGACGGAAAG
CTAAAGAGGAGAGAAGATGGTGGGAAGAGGAAGAGAAGAGGAGAAATGTG
GAGAGAATAAGAGAAGACAGGGCAAGGAAGCTTTATGAGGAAGAAATGAG
ACTGCTGGAAGAGCGAGAAAGATTTGCTGAGATCACAAGATACACTGAAG
ACATTCGAAGAGAGAGGGAGGAAGAGGAACGCCAAAAAGCAAAGAAGAAA
AAGAAGAAAAAGGCTGAAATAAAAGAGGATTATTTAGAAGACTACAGGAC
AAGAAGAAATGACAGAAGAGCACCGGAAAGAGATCGAGGTGCAAAAAGGA
AACCTGTTGAGTTAGGACGATATGGTGCAGAGTATGTCCCTCCAACAAAG
CGGCGCAGAGGGGGAGAGGTTGGTTTGGCCAACATCTTAGAGCGGATTGT
AGAAACACTTAGAGATAATACCGAGGTGTCCTATCTGTTCTTAAAACCAG
TGTCCAAGAAGGAGGCCCCTGACTACTTGAACATTGTAAAGCACCCAATG
GATTTGTCCACGATAAGGGACAAGGTTAGGCGGATGGAATACAAAAATCA
AGAAGAATTTAGGCATGATGTATGGCAGATTGCCTACAACGCTCATATCT
ACAATGATGGTCGTAATCCTGGTATTCCTCCTCTTGCCGATCAGCTTTTG
GAGCTTTGTGACTACTTGCTACATGAGTCTTCTGATAGCTTGGCTGAAGC
TGAAGCAGGTATAGGGGAAGCTTAATCGGGTAACACATTTAAAATCATTC
ATCATCTGAAAGCCAAAATTCCCTCACAGTAGAACTGCTGCTTCTCTGGG
TATTAGGGGTTTCCAGGCTTTGATGAACCATGGTAATAGAGCTTTGCATA
TGTATAGTTGAAACCTCTAGTGCTCGAGTCGTTTCAGGCATAAAAAAGAA
CCTAGTTCATATAGGATTATTATGGTTAAGAAAAAGGGATGATGACAACC
TAGGTGACATAGCCAGTAAGGTCGTCTAGAGATGAAAGCTTGTAGTGAAG
CAGATCCCAGTTGAAAGCATTTGCTGTTGAGGACTAAAAGACCCCCAAGG
CAGTCATTCAGAAGAGCTTCATGTCTGCATACTGTTGGCCAATAGATGAA
TCATTCCCATGAAAATATGGGACCTATCAGGCAATTATCTTGAAGAGCTT
TCATCTTTTGGCATTAATTATGTTTTACTTGGGGGAAGAATCTGAAGCTG
GTGGGTGAAATGCTTCAGTTGTTTACAAGATGAAAAAACTTGGGCAGTCA
AAAGTCCTTTCCACATAGGTTAGTGTGATTCAAGTTTTATTTAACATTTT
TAATAATAACTTGTGAGAGAGAGGGAAGCTGATATATAGTGAAGAATTTT
GATGCATAATTGATAACTCTGTACCATAAATATCTATGTAACCTCTAATG
TATTCTTCTCCCTTTTTTGTTTCCG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR001487Bromodomain
IPR018359Bromodomain_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding