g.arboreum_cottongen_reftransV1_0001675, g.arboreum_cottongen_reftransV1_0001675 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001675
Unique Nameg.arboreum_cottongen_reftransV1_0001675
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1896
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeg.arboreum_cottongen_reftransV1_0001675:1..1896 .
Chr1:110649042..110652546 -
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A0D2NES5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G267600 PE=4 SV=1)

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 534/544 (98.16%), Postives = 541/544 (99.45%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNP+MAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVK NQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTS+MKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASK+CPTPLRTPNQVSISGK KQSSATPWSENQSARTPVNSSASVSKTARGKWNFL TDCSKIL+ACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLK+KAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKN+CFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH
Sbjct:    1 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNPQMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKVNQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSRMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKDCPTPLRTPNQVSISGKLKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLHTDCSKILTACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKDKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNSCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 544          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A0D2M3M6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G267600 PE=4 SV=1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 534/545 (97.98%), Postives = 541/545 (99.27%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQ-RLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNP+MAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVK NQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTS+MKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASK+CPTPLRTPNQVSISGK KQSSATPWSENQSARTPVNSSASVSKTARGKWNFL TDCSKIL+ACRNKSQSPGIFASFNLRTEERAARRKQ RLEEKFNVIQEQKVQQQTTLK+KAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKN+CFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH
Sbjct:    1 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNPQMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKVNQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSRMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKDCPTPLRTPNQVSISGKLKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLHTDCSKILTACRNKSQSPGIFASFNLRTEERAARRKQARLEEKFNVIQEQKVQQQTTLKDKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNSCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 545          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A0D2Q4S3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G267600 PE=4 SV=1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 525/544 (96.51%), Postives = 532/544 (97.79%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNP+MAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVK NQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTS+MKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASK+CPTPLRTPNQVSISGK KQSSATPWSENQSARTPVNSSASVSKTARGKWNFL T+         NKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLK+KAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKN+CFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH
Sbjct:    1 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNPQMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKVNQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSRMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKDCPTPLRTPNQVSISGKLKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLHTE---------NKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKDKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNSCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 535          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A0B0PHB5_GOSAR (Translation initiation factor IF-2 OS=Gossypium arboreum GN=F383_09470 PE=4 SV=1)

HSP 1 Score: 1002.28 bits (2590), Expect = 0.000e+0
Identity = 523/545 (95.96%), Postives = 523/545 (95.96%), Query Frame = -3
Query:  200 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQHA 1834
            MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSP                      EKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQHA
Sbjct:    1 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKTLAARKAAALLEQANAAAATNATESEAQNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSP----------------------EKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQHA 523          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A061EDE2_THECC (TPX2 family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_017060 PE=4 SV=1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 413/585 (70.60%), Postives = 451/585 (77.09%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSE----------------------------------FVKVQSS------SVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKE-RTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MG+S CLMQPFSYTAG+PNEAKEGNP+HGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERY+RPGSVAQKKAFFEAHYK+LAARKAAALLEQANAAA +                 G ++D     SE                                  FVK +S       SV E  VLLEN MKNE+ E+    VDK  I D+E++ETTQV+  CVK +Q R L +  E ELSEGTQMEKPLLK   T++DEFEVTSK KP+ SSSKV A ARTSK+PSSPAKF AP RPN GNNLTPM KKSAMDIS+RKRSTPK SHKSINFT A EFSK TSTII+KIDGSRI SNSKASKEC TPLRTPN  S SG+PKQ SATPWSEN+SARTP NSSASVSKTARGKWNFLPTDCSK LSACRNKSQSPGIFASF+LRTEERAARRKQRLEEKFNV QEQKVQQQTTLKEKA  E KKLRQSFCFKARPLPDFYKE RTPKDQ+QKVPLT+PESP +GRKSTP KA   +SK+S+ PH+KS IKN CF  V EKKN+ S RSL +R+   AH NT+PNIQH
Sbjct:    1 MGESACLMQPFSYTAGIPNEAKEGNPVHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYSRPGSVAQKKAFFEAHYKSLAARKAAALLEQANAAANSAKESEVE----------GGVHDITTQGSEMTNSNSQIPVLDQEVKAPSTKAGSIHDGKENNSDFVKFESGKVEGDDSVAEHHVLLENCMKNESIERKA-SVDKVVIRDVELRETTQVE-KCVKVDQPRQLREIIESELSEGTQMEKPLLKSFNTSQDEFEVTSKKKPTHSSSKVSAYARTSKVPSSPAKFTAPTRPNKGNNLTPMAKKSAMDISDRKRSTPKPSHKSINFTPATEFSKITSTIIQKIDGSRIASNSKASKECATPLRTPNTASTSGRPKQPSATPWSENRSARTPFNSSASVSKTARGKWNFLPTDCSKFLSACRNKSQSPGIFASFSLRTEERAARRKQRLEEKFNVSQEQKVQQQTTLKEKAEAELKKLRQSFCFKARPLPDFYKERRTPKDQMQKVPLTQPESPALGRKSTPSKAGTAQSKNSL-PHQKSLIKNTCFKQVPEKKNQVSVRSLTTRVPAPAHGNTTPNIQH 572          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A061EK20_THECC (TPX2 family protein, putative isoform 2 OS=Theobroma cacao GN=TCM_017060 PE=4 SV=1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 404/585 (69.06%), Postives = 443/585 (75.73%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSE----------------------------------FVKVQSS------SVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKE-RTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MG+S CLMQPFSYTAG+PNEAKEGNP+HGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERY+RPGSVAQKKAFFEAHYK+LAARKAAALLEQANAAA +                 G ++D     SE                                  FVK +S       SV E  VLLEN MKNE+ E+    VDK  I D+E++ETTQV+  CVK +Q R L +  E ELSEGTQMEKPLLK   T++DEFEVTSK KP+ SSSKV A ARTSK+PSSPAKF AP RPN GNNLTPM KKSAMDIS+RKRSTPK SHKSINFT A EFSK TSTII+KIDGSRI SNSKASKEC TPLRTPN  S SG+PKQ SATPWSEN+SARTP NSSASVSKTARGKWNFLPT+         NKSQSPGIFASF+LRTEERAARRKQRLEEKFNV QEQKVQQQTTLKEKA  E KKLRQSFCFKARPLPDFYKE RTPKDQ+QKVPLT+PESP +GRKSTP KA   +SK+S+ PH+KS IKN CF  V EKKN+ S RSL +R+   AH NT+PNIQH
Sbjct:    1 MGESACLMQPFSYTAGIPNEAKEGNPVHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYSRPGSVAQKKAFFEAHYKSLAARKAAALLEQANAAANSAKESEVE----------GGVHDITTQGSEMTNSNSQIPVLDQEVKAPSTKAGSIHDGKENNSDFVKFESGKVEGDDSVAEHHVLLENCMKNESIERKA-SVDKVVIRDVELRETTQVE-KCVKVDQPRQLREIIESELSEGTQMEKPLLKSFNTSQDEFEVTSKKKPTHSSSKVSAYARTSKVPSSPAKFTAPTRPNKGNNLTPMAKKSAMDISDRKRSTPKPSHKSINFTPATEFSKITSTIIQKIDGSRIASNSKASKECATPLRTPNTASTSGRPKQPSATPWSENRSARTPFNSSASVSKTARGKWNFLPTE---------NKSQSPGIFASFSLRTEERAARRKQRLEEKFNVSQEQKVQQQTTLKEKAEAELKKLRQSFCFKARPLPDFYKERRTPKDQMQKVPLTQPESPALGRKSTPSKAGTAQSKNSL-PHQKSLIKNTCFKQVPEKKNQVSVRSLTTRVPAPAHGNTTPNIQH 563          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A061ECE1_THECC (TPX2 family protein, putative isoform 3 OS=Theobroma cacao GN=TCM_017060 PE=4 SV=1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 389/585 (66.50%), Postives = 427/585 (72.99%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSE----------------------------------FVKVQSS------SVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKE-RTPKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MG+S CLMQPFSYTAG+PNEAKEGNP+HGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERY+RPGSVAQKKAFFEAHYK+LAARKAAALLEQANAAA +                 G ++D     SE                                  FVK +S       SV E  VLLEN MKNE+ E+    VDK  I D+E++ETTQV+  CVK +Q R L +  E ELSEGTQMEKPLLK   T++DEFEVTSK KP+ SSSKV A ARTSK+PSSPAKF AP RPN GNNLTPM KKSAMDIS+RKRSTPK SHKSINFT A EFSK TSTII+KIDGSRI SNSKASKEC TPLRTPN  S SG+PKQ SATPWSEN+S                         CSK LSACRNKSQSPGIFASF+LRTEERAARRKQRLEEKFNV QEQKVQQQTTLKEKA  E KKLRQSFCFKARPLPDFYKE RTPKDQ+QKVPLT+PESP +GRKSTP KA   +SK+S+ PH+KS IKN CF  V EKKN+ S RSL +R+   AH NT+PNIQH
Sbjct:    1 MGESACLMQPFSYTAGIPNEAKEGNPVHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYSRPGSVAQKKAFFEAHYKSLAARKAAALLEQANAAANSAKESEVE----------GGVHDITTQGSEMTNSNSQIPVLDQEVKAPSTKAGSIHDGKENNSDFVKFESGKVEGDDSVAEHHVLLENCMKNESIERKA-SVDKVVIRDVELRETTQVE-KCVKVDQPRQLREIIESELSEGTQMEKPLLKSFNTSQDEFEVTSKKKPTHSSSKVSAYARTSKVPSSPAKFTAPTRPNKGNNLTPMAKKSAMDISDRKRSTPKPSHKSINFTPATEFSKITSTIIQKIDGSRIASNSKASKECATPLRTPNTASTSGRPKQPSATPWSENRS-------------------------CSKFLSACRNKSQSPGIFASFSLRTEERAARRKQRLEEKFNVSQEQKVQQQTTLKEKAEAELKKLRQSFCFKARPLPDFYKERRTPKDQMQKVPLTQPESPALGRKSTPSKAGTAQSKNSL-PHQKSLIKNTCFKQVPEKKNQVSVRSLTTRVPAPAHGNTTPNIQH 547          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A061ECK3_THECC (TPX2 family protein, putative isoform 4 OS=Theobroma cacao GN=TCM_017060 PE=4 SV=1)

HSP 1 Score: 524.628 bits (1350), Expect = 8.310e-178
Identity = 285/417 (68.35%), Postives = 314/417 (75.30%), Query Frame = -3
Query:  674 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHY-------------KXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRM-----------AETGSIYDCKENNSEFVKVQSS------SVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACR 1834
            MG+S CLMQPFSYTAG+PNEAKEGNP+HGLGQSISFGR+MSESLAWEKWSTFSHNKYVEEAERY+RPGSVAQKKAFFEAHY             +  AA  +A   E            SE  N N ++            + GSI+D KENNS+FVK +S       SV E  VLLEN MKNE+ E+   V DK  I D+E++ETTQV+  CVK +Q R L +  E ELSEGTQMEKPLLK   T++DEFEVTSK KP+ SSSKV A ARTSK+PSSPAKF AP RPN GNNLTPM KKSAMDIS+RKRSTPK SHKSINFT A EFSK TSTII+KIDGSRI SNSKASKEC TPLRTPN  S SG+PKQ SATPWSEN+SARTP NSSASVSKTARGKWNFLPTDCSK LSACR
Sbjct:    1 MGESACLMQPFSYTAGIPNEAKEGNPVHGLGQSISFGRFMSESLAWEKWSTFSHNKYVEEAERYSRPGSVAQKKAFFEAHYKSLAARKAAALLEQANAAANSAKESEVEGGVHDITTQGSEMTNSNSQIPVLDQEVKAPSTKAGSIHDGKENNSDFVKFESGKVEGDDSVAEHHVLLENCMKNESIERKASV-DKVVIRDVELRETTQVEK-CVKVDQPRQLREIIESELSEGTQMEKPLLKSFNTSQDEFEVTSKKKPTHSSSKVSAYARTSKVPSSPAKFTAPTRPNKGNNLTPMAKKSAMDISDRKRSTPKPSHKSINFTPATEFSKITSTIIQKIDGSRIASNSKASKECATPLRTPNTASTSGRPKQPSATPWSENRSARTPFNSSASVSKTARGKWNFLPTDCSKFLSACR 415          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: B9GJA8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s36260g PE=4 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.769e-161
Identity = 296/566 (52.30%), Postives = 376/566 (66.43%), Query Frame = -3
Query:  203 MGDSTCLMQPFSYTAGLPNEAKEGNPIHGLGQSISFGRYMSESLAWEKWSTFSHNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEIT---DLEVKETTQVKN------------NCVK-ANQSRLLGDD-----KELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRIDSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERT-PKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MGD+TC+MQPFSY AG+ N+AKEGNPIH LGQSISFGR+MS+SL+WEKWS+FSHN+YVEEAE+++RPGSVAQKKAFFEAHY+ LAARKAAALLEQANA A                   G I+D    +S  V   S    + + +    +  EA      V D    T   D+E  E++ V+             NCVK    ++++  D     KE+ELS   QMEKPLLK   + +D+    SK KP+ SSSK     + SK+PS+PAK    +R    N  TP++KKSA++  ER++ TPKS+HKS+NFT A+EF++ TS+IIRKID SR+ S+SK+SK+CPTP RTP  +    + K   ATP SE + A+TP++ S S SKT R KW+FLP DCS  +++ RN+SQSP     F+ RTEERAARRK++LEEKFN  Q QKVQ Q TLKEKA TE K+LRQS CFKARPLPDFYK+R  P +Q++KVPLT  ESP  GRK TP K   + S S +P  + SS+KN+      +KK+  + RSLASR+  S HENTSPNIQH
Sbjct:    1 MGDTTCVMQPFSYAAGISNDAKEGNPIHALGQSISFGRFMSDSLSWEKWSSFSHNRYVEEAEKFSRPGSVAQKKAFFEAHYRNLAARKAAALLEQANAEANNVQEPENE----------GGIHDKTTQDSLTVATNSQEAGDREEVHVQQVNCEA----SFVADDNTRTSNVDMERFESSNVEEVEPSAENEILVENCVKNETLNQIVKVDNKEEVKEMELSVSKQMEKPLLKDFMSCKDDAASMSKKKPAVSSSKSSIYDKASKLPSTPAKPAPSVRAKKENTATPISKKSALESVERRKPTPKSTHKSMNFTPAREFNRITSSIIRKIDNSRVGSHSKSSKDCPTPSRTPMMMVSIAESKHPLATPQSEKRRAKTPLHPSTSGSKTVRSKWHFLPKDCSMFMTSSRNRSQSPSASIPFSFRTEERAARRKEKLEEKFNAYQAQKVQLQVTLKEKAETELKRLRQSLCFKARPLPDFYKQRVAPNNQMEKVPLTHSESPEPGRKMTPSK---IRSASQLP--QWSSLKNSGSKDAMQKKS-DNPRSLASRLKASPHENTSPNIQH 546          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Match: A0A067EDV5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g009164mg PE=4 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 9.687e-156
Identity = 297/553 (53.71%), Postives = 361/553 (65.28%), Query Frame = -3
Query:  203 MGDSTCLMQ-----PFSYTAGLPNEAKE-GNPIHGLGQSISFGRYMSESLAWEKWSTFS-HNKYVEEAERYARPGSVAQKKAFFEAHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPNPRMAETGSIYDCKENNSEFVKVQSSSVDEPQVLLENNMKNEAFEKNGVVVDKAEITDLEVKETTQVKNNCVKANQSRLLGDDKELELSEGTQMEKPLLKGGKTNEDEFEVTSKMKPSQSSSKVFANARTSKMPSSPAKFKAPLRPNNGNNLTPMTKKSAMDISERKRSTPKSSHKSINFTHAKEFSKFTSTIIRKIDGSRI-DSNSKASKECPTPLRTPNQVSISGKPKQSSATPWSENQSARTPVNSSASVSKTARGKWNFLPTDCSKILSACRNKSQSPGIFASFNLRTEERAARRKQRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERT-PKDQIQKVPLTKPESPGIGRKSTPCKASIVESKSSVPPHRKSSIKNNCFMHVSEKKNRTSARSLASRIAMSAHENTSPNIQH 1834
            MG+STCLMQ     PFSY +G PNEAKE GNPIH LGQS+SFGR+MSESLAWEKWS+FS HNKYVEEAERY+RPGSVAQKKAFFEAHYK LAARK AA L +    A+ N    E+Q         G + +    +S+ + V+    +   +L+  +  N    +  V  +K E  + E  ++T      V  +  R   D K   LS   QM+KP LK   +N+D+    SK KPS SSSK     R +K PS+PAK  APL+     N TP+ KKSA+D ++ KRSTPKS HKSI  T A+E ++ TSTI+RKIDGS++  SNSKASK+C TPL TP   S++G PK   ATPWSEN+   TP +S+   SKT R +WNFLPTDCSK LSACRNK QSP  F  F LRTEERAARRK++LEEKFN  Q QK+Q+Q TLKEKA TE +KLRQ+ CFKARPLP FYKER  PK Q+ K P T+P+SP +        AS  ++K S P  R  + K+    HV EKK+  S RSLASR     HEN SPNIQH
Sbjct:    1 MGESTCLMQMQVQQPFSYVSGFPNEAKEEGNPIHALGQSVSFGRFMSESLAWEKWSSFSSHNKYVEEAERYSRPGSVAQKKAFFEAHYKELAARKKAAALLEQAQDASNNNLAGESQP-------EGEVENVTAQDSQTIAVEEQ--EAATILVHESESNSVLGQRSVDGEK-ETENCEKTKSTNQLERVVVVDSKREAKDSK---LSGANQMQKPRLKSSNSNQDDRASMSKKKPSFSSSKSLNFGRATKTPSTPAKPTAPLQSTKEINATPIKKKSAIDFADNKRSTPKSIHKSIYLTPAREINRLTSTIVRKIDGSKVMGSNSKASKDCSTPLMTPTAASVNGAPKHPLATPWSENRRDGTPHDSNMG-SKTVRARWNFLPTDCSKFLSACRNKLQSPNSFTPFRLRTEERAARRKEKLEEKFNANQIQKLQKQVTLKEKAETEIRKLRQTLCFKARPLPHFYKERAIPKSQMNKDPPTRPQSPKLT-------ASTFQTKPSTPRQRPPT-KHIGSDHVLEKKSHASTRSLASRPTKITHENKSPNIQH 531          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy Swiss-Prot
Match: WVD2_ARATH (Protein WAVE-DAMPENED 2 OS=Arabidopsis thaliana GN=WVD2 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 8.080e-11
Identity = 44/124 (35.48%), Postives = 72/124 (58.06%), Query Frame = -3
Query:  353 DCSKILSACRNKSQSPGIFASFNLRTEERAARRK---QRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTP-KDQIQKVPLTKPESPGIG---RKSTPCKASIVES 703
            DCS + S+ +N         +   R+ +RA +RK   Q+LEEK   ++ ++++ +   KE+     K+LR++  FKA P+PDFY +R P K +++K PLT+P+SP +    RKS  C  +I  S
Sbjct:   67 DCS-VASSMKNAKSKVTHGTAPRFRSAQRAEKRKEYYQKLEEKHQALEAERIELEQRQKEEQEAAIKQLRKNLKFKANPVPDFYYQRPPVKPELKKFPLTRPKSPKLNLSRRKS--CSDAITSS 187          
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy Swiss-Prot
Match: WDL1_ARATH (Protein WVD2-like 1 OS=Arabidopsis thaliana GN=WDL1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 6.700e-8
Identity = 31/84 (36.90%), Postives = 56/84 (66.67%), Query Frame = -3
Query:  395 LRTEERAARRK---QRLEEKFNVIQEQKVQQQTTLKEKAGTEFKKLRQSFCFKARPLPDFYKERTP-KDQIQKVPLTKPESPGI 634
             R+ +RA +RK   Q+LEEK   ++ ++ + +   K++     K+LR++  FKA+P+P+FY E  P K +++K+PLT+P+SP +
Sbjct:  128 FRSAQRAEKRKEYYQKLEEKNQALEAERNELEQRQKDEQEAALKQLRKNLKFKAKPVPNFYYEAPPAKPELKKLPLTRPKSPKL 211          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2NES5_GOSRA0.000e+098.16Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2M3M6_GOSRA0.000e+097.98Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2Q4S3_GOSRA0.000e+096.51Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0B0PHB5_GOSAR0.000e+095.96Translation initiation factor IF-2 OS=Gossypium ar... [more]
A0A061EDE2_THECC0.000e+070.60TPX2 family protein, putative isoform 1 OS=Theobro... [more]
A0A061EK20_THECC0.000e+069.06TPX2 family protein, putative isoform 2 OS=Theobro... [more]
A0A061ECE1_THECC0.000e+066.50TPX2 family protein, putative isoform 3 OS=Theobro... [more]
A0A061ECK3_THECC8.310e-17868.35TPX2 family protein, putative isoform 4 OS=Theobro... [more]
B9GJA8_POPTR2.769e-16152.30Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A067EDV5_CITSI9.687e-15653.71Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001675 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
WVD2_ARATH8.080e-1135.48Protein WAVE-DAMPENED 2 OS=Arabidopsis thaliana GN... [more]
WDL1_ARATH6.700e-836.90Protein WVD2-like 1 OS=Arabidopsis thaliana GN=WDL... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 404..431
NoneNo IPR availablePANTHERPTHR31358FAMILY NOT NAMEDcoord: 206..532
coord: 1..177
NoneNo IPR availablePANTHERPTHR31358:SF12TPX2 (TARGETING PROTEIN FOR XKLP2) PROTEIN FAMILYcoord: 206..532
coord: 1..177
IPR027329TPX2, C-terminalPFAMPF06886TPX2coord: 401..454
e-value: 2.5E-10
score: 40.3

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001675 ID=g.arboreum_cottongen_reftransV1_0001675|Name=g.arboreum_cottongen_reftransV1_0001675|organism=Gossypium arboreum|type=contig|length=1896bp
ATCAACATTCGAATATGTTCGAAGGAACAAGTTTTGACAATATGTAACTA
AATGGTACTCTACTAATATGAATTTGCTAAGCTTTAGGAGGAGTTTTTTT
GTTGTACAGCCTCTCCATTTCATCCAATTCCAGGCATTGAGTAGTATTGT
GGGATTCATACAATGGACATGCCAAATTCTACAATTTAGTCAAACCTTAT
GCATGCTGGATATTTGGAGATGTGTTCTCATGAGCAGACATTGCAATTCG
TGAAGCAAGAGAACGAGCTGAAGTTCGGTTTTTCTTTTCCGAGACATGCA
TGAAGCAATTGTTCTTAATCGAAGACTTCCGATGAGGAGGAACAGAGCTT
TTGCTTTCAACAATGCTTGCTTTGCAGGGAGTAGATTTTCTTCCTATGCC
AGGTGATTCAGGTTTTGTCAATGGAACCTTTTGAATCTGATCTTTAGGTG
TTCTTTCTTTATAAAAATCCGGCAATGGTCTTGCCTTGAAGCAAAAGCTT
TGTCGTAGTTTCTTGAATTCGGTCCCTGCTTTTTCCTTGAGTGTTGTTTG
CTGTTGTACTTTTTGTTCCTGAATAACATTGAATTTCTCTTCAAGCCTCT
GTTTTCTTCTAGCAGCTCTTTCTTCAGTTCTCAAGTTGAAAGATGCAAAT
ATACCAGGTGACTGTGATTTGTTTCTGCAGGCACTCAAAATCTTTGAACA
ATCTGTAGGAAGAAAGTTCCATTTTCCACGAGCTGTTTTGCTGACACTGG
CTGAGGAATTAACTGGTGTTCTAGCACTTTGGTTTTCAGACCAAGGGGTG
GCCGAGGATTGTTTCGGTTTTCCACTTATAGACACCTGGTTCGGAGTCCT
TAAAGGTGTAGGACATTCTTTAGATGCTTTAGAATTCGAATCAATTCTTG
AACCATCAATCTTTCTGATGATAGTGGAAGTAAATTTACTGAATTCTTTT
GCATGGGTGAAGTTGATTGACTTGTGACTTGATTTTGGTGTTGATCTCTT
TCTTTCAGATATGTCCATTGCAGACTTCTTGGTCATTGGCGTGAGATTGT
TTCCATTGTTGGGTCGAAGTGGAGCTTTGAATTTTGCAGGTGAAGATGGC
ATCTTGGATGTTCTTGCATTAGCAAACACCTTTGAAGAAGATTGGGAAGG
TTTCATCTTGCTTGTTACCTCAAATTCATCTTCATTGGTTTTGCCACCCT
TAAGTAGAGGTTTCTCCATTTGAGTCCCTTCACTAAGCTCCAATTCTTTA
TCATCTCCAAGTAGTCTTGACTGGTTAGCTTTAACACAATTGTTCTTCAC
TTGGGTTGTTTCTTTAACCTCCAAATCTGTAATTTCAGCCTTATCAACAA
CCACACCATTCTTTTCAAAAGCTTCATTTTTCATATTATTCTCCAAAAGA
ACTTGGGGTTCATCAACTGAGCTGCTTTGAACCTTCACAAATTCTGAATT
ATTCTCTTTACAATCATAAATGGAGCCAGTTTCTGCCATTCGAGGGTTTG
GGTTTTGAGCTTCACTTTCAGTAGCATTAGTGGCAGCAGCAGCATTAGCT
TGTTCAAGCAAGGCAGCTGCTTTCCTAGCAGCAAGGGTCTTATAATGAGC
TTCAAAGAAAGCTTTTTTTTGAGCTACTGAACCTGGCCTAGCATATCTCT
CAGCTTCTTCAACATATTTGTTATGAGAAAAGGTTGACCATTTTTCCCAA
GCTAAAGATTCAGACATGTATCTGCCAAATGAAATTGACTGTCCAAGACC
ATGAATTGGGTTTCCCTCTTTGGCTTCATTGGGAAGGCCTGCAGTGTAAG
AAAATGGTTGCATGAGACAAGTTGAGTCCCCCATGTTTGCAAAAATGTTT
CTTTGGCAAAAGCCCTTTCTCTAAACTACTAAAAAAAGGGGAAATA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR027329TPX2_C