g.arboreum_cottongen_reftransV1_0005499, g.arboreum_cottongen_reftransV1_0005499 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0005499
Unique Nameg.arboreum_cottongen_reftransV1_0005499
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length1850
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr5chromosomeg.arboreum_cottongen_reftransV1_0005499:1..1850 .
Chr5:52137385..52142598 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A0B0PAS3_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_03029 PE=4 SV=1)

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 3
Query:    3 QLSDSKXXXXXXXXXXXXXXXXXXXXXXXSRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL 1454
            QLSDSKDFGIHDEIDDDDDHYNDGIDSNDSRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLRSSPKKKPRRRKFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL
Sbjct:  217 QLSDSKDFGIHDEIDDDDDHYNDGIDSNDSRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLRSSPKKKPRRRKFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL 700          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A0D2N8Y7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G074800 PE=4 SV=1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 471/484 (97.31%), Postives = 475/484 (98.14%), Query Frame = 3
Query:    3 QLSDSKXXXXXXXXXXXXXXXXXXXXXXXSRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL 1454
            QLSDSKDFGIH+EIDDDDDHYND IDSNDSRKEDYDDFGHDKDYILDEAKSHD+NVNESSTSFNAKTNNEH VKEVKEESSLSREASQDFD VDADSHHAGSL  KSGKNLRSS KKKPRRRKFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQ+LQEREESF ARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSF YTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKR +QQRATL
Sbjct:  218 QLSDSKDFGIHNEIDDDDDHYNDSIDSNDSRKEDYDDFGHDKDYILDEAKSHDENVNESSTSFNAKTNNEHVVKEVKEESSLSREASQDFDHVDADSHHAGSLGRKSGKNLRSSSKKKPRRRKFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQSLQEREESFLARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFTYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRNVQQRATL 701          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A061FRS1_THECC (Uncharacterized protein isoform 4 OS=Theobroma cacao GN=TCM_036343 PE=4 SV=1)

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 394/455 (86.59%), Postives = 418/455 (91.87%), Query Frame = 3
Query:   90 SRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL 1454
            S+ EDYDDFGHDK+  +DEAKSHD++V E ST   +KT   H VKE KEES LSREAS DF DVDA+S H GSL  K  K+ R+  K+KPRRRKFSGSCEMKL+NSTHLVEP+ESRKFARFSLQYKQMEE  EGE+QWVP FAGHQ+LQEREESF A DQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTR SRKNVCFVMFVDE TMQTL+SEGQ+PDGGFIGLWKIVVVKNLPY DMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQF+FYQADGLK+F++SDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRR NPDKPFYLNMFKDCERRA+AKLFRHRS+EKR +QQ+A L
Sbjct:  145 SQTEDYDDFGHDKEDNVDEAKSHDEHVKEFSTF--SKTKERHVVKEGKEESMLSREASGDFGDVDANSQHVGSLGRKGAKSSRADSKRKPRRRKFSGSCEMKLLNSTHLVEPLESRKFARFSLQYKQMEENSEGEEQWVPTFAGHQSLQEREESFLAHDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRLSRKNVCFVMFVDEVTMQTLFSEGQSPDGGFIGLWKIVVVKNLPYADMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFEFYQADGLKKFNSSDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRMNPDKPFYLNMFKDCERRAIAKLFRHRSEEKRNVQQQAML 597          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A061FJZ2_THECC (Uncharacterized protein isoform 2 OS=Theobroma cacao GN=TCM_036343 PE=4 SV=1)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 394/455 (86.59%), Postives = 418/455 (91.87%), Query Frame = 3
Query:   90 SRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL 1454
            S+ EDYDDFGHDK+  +DEAKSHD++V E ST   +KT   H VKE KEES LSREAS DF DVDA+S H GSL  K  K+ R+  K+KPRRRKFSGSCEMKL+NSTHLVEP+ESRKFARFSLQYKQMEE  EGE+QWVP FAGHQ+LQEREESF A DQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTR SRKNVCFVMFVDE TMQTL+SEGQ+PDGGFIGLWKIVVVKNLPY DMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQF+FYQADGLK+F++SDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRR NPDKPFYLNMFKDCERRA+AKLFRHRS+EKR +QQ+A L
Sbjct:  252 SQTEDYDDFGHDKEDNVDEAKSHDEHVKEFSTF--SKTKERHVVKEGKEESMLSREASGDFGDVDANSQHVGSLGRKGAKSSRADSKRKPRRRKFSGSCEMKLLNSTHLVEPLESRKFARFSLQYKQMEENSEGEEQWVPTFAGHQSLQEREESFLAHDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRLSRKNVCFVMFVDEVTMQTLFSEGQSPDGGFIGLWKIVVVKNLPYADMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFEFYQADGLKKFNSSDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRMNPDKPFYLNMFKDCERRAIAKLFRHRSEEKRNVQQQAML 704          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A061FJH0_THECC (Uncharacterized protein isoform 1 OS=Theobroma cacao GN=TCM_036343 PE=4 SV=1)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 398/477 (83.44%), Postives = 423/477 (88.68%), Query Frame = 3
Query:   90 SRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNSTHLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDGGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRATL*NVCCIIKPFLLNIKRIIFCTL 1520
            S+ EDYDDFGHDK+  +DEAKSHD++V E ST   +KT   H VKE KEES LSREAS DF DVDA+S H GSL  K  K+ R+  K+KPRRRKFSGSCEMKL+NSTHLVEP+ESRKFARFSLQYKQMEE  EGE+QWVP FAGHQ+LQEREESF A DQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTR SRKNVCFVMFVDE TMQTL+SEGQ+PDGGFIGLWKIVVVKNLPY DMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQF+FYQADGLK+F++SDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRR NPDKPFYLNMFKDCERRA+AKLFRHRS+EKR +QQ+A       I K   + I     C L
Sbjct:  252 SQTEDYDDFGHDKEDNVDEAKSHDEHVKEFSTF--SKTKERHVVKEGKEESMLSREASGDFGDVDANSQHVGSLGRKGAKSSRADSKRKPRRRKFSGSCEMKLLNSTHLVEPLESRKFARFSLQYKQMEENSEGEEQWVPTFAGHQSLQEREESFLAHDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRLSRKNVCFVMFVDEVTMQTLFSEGQSPDGGFIGLWKIVVVKNLPYADMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQRDPLQLLDYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFEFYQADGLKKFNSSDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRMNPDKPFYLNMFKDCERRAIAKLFRHRSEEKRNVQQQA-------IKKKEPIGIPSSALCAL 719          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A067LFD0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_03910 PE=4 SV=1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 336/456 (73.68%), Postives = 375/456 (82.24%), Query Frame = 3
Query:   99 EDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKT---NNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNST-HLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPD-GGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRY-IQQRA 1448
            EDYDD  HD         SH ++  E S   +A+T   N +   +EV E+       S+   +VD +S H  S   +     +S  K+KPRRRKFSG CEMK +NST  LVEP ESRKFARFSLQY + E+KP  E++W PRFAGHQ  QERE+SF   DQK+NCGFVKGP+G PSTGFDLAEDD NYISRCHIAVISCIFGNSDRLR+PAGKMVTR S+KNVCFV+F+DE T+QT+ SEGQ PD  GFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQ DPL +L+YFLWRKGHEYAISNHYDRHCVWEEVAQNK+LNKYNHTVIDEQF FYQADGLK+F+ASDPNKLLPSNVPEGS IVRAHTPMSNLFSCLWFNEV+RFTPRDQLSFAYTYQKL+R NP KPFYLNMFKDCERRA+AKLFRHRSDEKR+ ++Q+A
Sbjct:  255 EDYDDSEHDSGGHTVIGISHGEDDKEFSNVHDAETKVQNIDKGNREVSEDMLEKPMKSRTLGNVDNNSRHVRSSGSQYTTKSQSESKRKPRRRKFSGGCEMKFLNSTTQLVEPFESRKFARFSLQYVEREDKPNEEEEWEPRFAGHQTWQEREDSFLVHDQKVNCGFVKGPEGSPSTGFDLAEDDANYISRCHIAVISCIFGNSDRLRSPAGKMVTRVSKKNVCFVLFMDEVTLQTVSSEGQMPDRAGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQLDPLLVLEYFLWRKGHEYAISNHYDRHCVWEEVAQNKRLNKYNHTVIDEQFTFYQADGLKKFNASDPNKLLPSNVPEGSLIVRAHTPMSNLFSCLWFNEVDRFTPRDQLSFAYTYQKLKRMNPGKPFYLNMFKDCERRAIAKLFRHRSDEKRHTLRQQA 710          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: M5VJD9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002175mg PE=4 SV=1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 337/459 (73.42%), Postives = 382/459 (83.22%), Query Frame = 3
Query:   99 EDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESSLSRE-----ASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGS-CEMKLMNST-HLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPD-GGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRAT 1451
            ++Y+D GH  D+  DE KS D++  ES    +  TN+++   +V++ S+ S E      S++ D+V+    H    S +S K  RS+ K+KP+RRK+SGS CEMK +NST  L+EP+ESRKFARFS+QY Q E+KPEGE+ W PRFAGHQ LQERE SF A DQKI CGFVKGP+  PSTGFDLAEDD NYISRCHIAV+SCIFGNSDRLR P GK V+R SRK VCFVMFVDE T+QT+ SEGQ PD  GFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQ DPL +L+YFLWRKG+EYAISNHYDRHCVWEEVAQNK+LNKYNHT+ID+QF FYQADGL RF+A DPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRR NP KPF LNMFKDCERRA+AKLFRHRSDEK+ I+Q+AT
Sbjct:  247 DEYEDMGHQNDH-FDEEKSRDEDSGESIDLPDVGTNDQNVANKVEKVSTNSFEDDPVQHSRNLDEVNTKPRHVSIHSGQSSKKSRSTSKRKPKRRKYSGSSCEMKFLNSTAQLIEPLESRKFARFSMQYTQAEDKPEGEEHWEPRFAGHQTLQERENSFLANDQKIKCGFVKGPKESPSTGFDLAEDDTNYISRCHIAVMSCIFGNSDRLRMPYGKTVSRLSRKYVCFVMFVDEVTLQTISSEGQIPDRMGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQLDPLLILEYFLWRKGYEYAISNHYDRHCVWEEVAQNKRLNKYNHTIIDQQFAFYQADGLTRFNALDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRMNPGKPFQLNMFKDCERRAIAKLFRHRSDEKQNIRQKAT 704          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: A0A067H8J3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g004949mg PE=4 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 333/460 (72.39%), Postives = 374/460 (81.30%), Query Frame = 3
Query:   90 SRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESS-LSREAS---QDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNST-HLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPD-GGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRAT 1451
            +R  +YDD GHDK    D AK   +   ESS   +AK  +++ V++V+E SS LS ++S   Q+ D   A       +  +S K          ++ K   SCE+K++NST  LVEP+ESRKFARF LQY ++EEKP+GE +W PRFAGHQ+LQEREESF ARDQKINCGFVK P+GYPSTGFDLAEDD NY SRCHIAVISCIFGNSDRLR P GK VTR SRKNVCFVMF DE T+QTL SEGQ PD  GFIGLWK+VVVKNLPY DMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQRDPL +L+YFLWRKG+EYAISNHYDRHCVWEEVAQNKKLNKYNHTVID+QF FYQADGLKRFD SDP++LLPSNVPEGSFIVRAHTPMSNLFSCLWFNEV+RFT RDQLSFAYTYQKLRR NP K FYLNMFKDCERR++AKLFRHRS EKR ++Q+A 
Sbjct:  268 TRIGEYDDSGHDKGDHSDVAKIQSQYQRESSDLHDAKILHQNIVRKVEEVSSNLSVDSSLKSQNLDKFYATQRQVSLVGGQSTK------ASPKKKSKRRSSCEVKILNSTTQLVEPLESRKFARFFLQYTEVEEKPDGEAEWEPRFAGHQSLQEREESFLARDQKINCGFVKAPEGYPSTGFDLAEDDANYNSRCHIAVISCIFGNSDRLRIPVGKTVTRLSRKNVCFVMFTDELTLQTLSSEGQIPDRTGFIGLWKMVVVKNLPYDDMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQRDPLLILEYFLWRKGYEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDQQFAFYQADGLKRFDPSDPDRLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYQKLRRMNPSKMFYLNMFKDCERRSMAKLFRHRSAEKRGVRQQAA 721          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: V4T3V5_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10000424mg PE=4 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 332/460 (72.17%), Postives = 374/460 (81.30%), Query Frame = 3
Query:   90 SRKEDYDDFGHDKDYILDEAKSHDKNVNESSTSFNAKTNNEHAVKEVKEESS-LSREAS---QDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNST-HLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPD-GGFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRAT 1451
            +R  +YDD  HDK    D AK  ++   ESS   +AK  +++ V++V+E SS LS ++S   Q+ D   A       +  +S K          ++ K   SCE+K++NST  LVEP+ESRKFARF LQY ++EEKP+GE +W PRFAGHQ+LQEREESF ARDQKINCGFVK P+GYPSTGFDLAEDD NY SRCHIAVISCIFGNSDRLR P GK VTR SRKNVCFVMF DE T+QTL SEGQ PD  GFIGLWK+VVVKNLPY DMRRVGKIPKLLPHRLFP ARYSIWLDSKLRLQRDPL +L+YFLWRKG+EYAISNHYDRHCVWEEVAQNKKLNKYNHTVID+QF FYQADGLKRFD SDP++LLPSNVPEGSFIVRAHTPMSNLFSCLWFNEV+RFT RDQLSFAYTYQKLRR NP K FYLNMFKDCERR++AKLFRHRS EKR ++Q+A 
Sbjct:  268 TRVGEYDDSRHDKGDHSDVAKIQNQYQRESSDLHDAKILHQNIVRKVEEVSSNLSVDSSLKSQNLDKFYATQRQVSLVGGQSTK------ASPKKKSKRRSSCEVKILNSTTQLVEPLESRKFARFFLQYTEVEEKPDGEAEWEPRFAGHQSLQEREESFLARDQKINCGFVKAPEGYPSTGFDLAEDDANYNSRCHIAVISCIFGNSDRLRIPVGKTVTRLSRKNVCFVMFTDELTLQTLSSEGQIPDRTGFIGLWKMVVVKNLPYDDMRRVGKIPKLLPHRLFPSARYSIWLDSKLRLQRDPLLILEYFLWRKGYEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDQQFAFYQADGLKRFDPSDPDRLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYQKLRRMNPSKMFYLNMFKDCERRSMAKLFRHRSAEKRGVRQQAA 721          
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Match: I1NHB1_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=2)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 320/428 (74.77%), Postives = 365/428 (85.28%), Query Frame = 3
Query:  174 ESSTSFNAKTNNEHAVKEVKEESSLSREASQDFDDVDADSHHAGSLSHKSGKNLXXXXXXXXXXXXFSGSCEMKLMNST-HLVEPVESRKFARFSLQYKQMEEKPEGEDQWVPRFAGHQNLQEREESFFARDQKINCGFVKGPQGYPSTGFDLAEDDVNYISRCHIAVISCIFGNSDRLRTPAGKMVTRSSRKNVCFVMFVDEATMQTLYSEGQTPDG-GFIGLWKIVVVKNLPYTDMRRVGKIPKLLPHRLFPFARYSIWLDSKXXXXXXXXXXXXYFLWRKGHEYAISNHYDRHCVWEEVAQNKKLNKYNHTVIDEQFDFYQADGLKRFDASDPNKLLPSNVPEGSFIVRAHTPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRTNPDKPFYLNMFKDCERRAVAKLFRHRSDEKRYIQQRAT 1451
            E + SF+ + N++   ++V+  SS +++ S D      ++ HA   + +S +      KKK +RRKFSGSCEMKL+NST  LVEP+ESRKF+RF+LQY + EEKP G++QWVPRFAGHQ+L+ERE SF ARDQ+INCGFVKGP+G  STGFDL EDD NYISRCHIAVISCIFGNSDRLRTPA K VTR SRKNVCFVMF DE T++TL SEG  PD  GFIG WK+VVVKNLPY DMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQ DPL +L+YFLWRKG+E+AISNHYDRHCVWEEVA+NKKLNKYNHTVIDEQF FY+ADGL++FDASDPNKLLPSNVPEGSFI+RAHTPMSNLFSCLWFNEV+RFTPRDQLSFAYTYQKLRR NPDKPF+LNMFKDCERR +AKLFRHR DEKR  +Q+ T
Sbjct:  274 EPNDSFDEENNDDVTSEDVEGTSSFNKKKSHD---GKTNAKHANPSNGQSTRKSHPETKKKAKRRKFSGSCEMKLLNSTSQLVEPLESRKFSRFNLQYTETEEKPLGDEQWVPRFAGHQSLEERESSFLARDQQINCGFVKGPEGSQSTGFDLTEDDANYISRCHIAVISCIFGNSDRLRTPATKTVTRLSRKNVCFVMFTDEITIRTLSSEGHVPDRMGFIGFWKLVVVKNLPYDDMRRVGKIPKLLPHRLFPFARYSIWLDSKLRLQLDPLLILEYFLWRKGYEFAISNHYDRHCVWEEVARNKKLNKYNHTVIDEQFAFYRADGLEKFDASDPNKLLPSNVPEGSFIIRAHTPMSNLFSCLWFNEVDRFTPRDQLSFAYTYQKLRRMNPDKPFHLNMFKDCERRHIAKLFRHRLDEKRINRQKTT 698          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0PAS3_GOSAR0.000e+0100.00Uncharacterized protein OS=Gossypium arboreum GN=F... [more]
A0A0D2N8Y7_GOSRA0.000e+097.31Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061FRS1_THECC0.000e+086.59Uncharacterized protein isoform 4 OS=Theobroma cac... [more]
A0A061FJZ2_THECC0.000e+086.59Uncharacterized protein isoform 2 OS=Theobroma cac... [more]
A0A061FJH0_THECC0.000e+083.44Uncharacterized protein isoform 1 OS=Theobroma cac... [more]
A0A067LFD0_JATCU0.000e+073.68Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
M5VJD9_PRUPE0.000e+073.42Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
A0A067H8J3_CITSI0.000e+072.39Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]
V4T3V5_9ROSI0.000e+072.17Uncharacterized protein OS=Citrus clementina GN=CI... [more]
I1NHB1_SOYBN0.000e+074.77Uncharacterized protein OS=Glycine max PE=4 SV=2[more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0005499 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006852Protein of unknown function DUF616PFAMPF04765DUF616coord: 23..341
e-value: 1.2E-144
score: 481.2
NoneNo IPR availablePANTHERPTHR12956:SF24SUBFAMILY NOT NAMEDcoord: 1..354
NoneNo IPR availablePANTHERPTHR12956ALKALINE CERAMIDASE-RELATEDcoord: 1..354

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0005499 ID=g.arboreum_cottongen_reftransV1_0005499|Name=g.arboreum_cottongen_reftransV1_0005499|organism=Gossypium arboreum|type=contig|length=1850bp
ATCAGCTCTCTGACAGTAAGGATTTTGGAATTCATGATGAGATTGATGAT
GATGATGACCATTATAATGATGGCATTGATTCTAATGATAGTCGCAAGGA
AGATTATGATGATTTTGGACATGACAAGGACTATATTTTAGATGAAGCAA
AATCTCATGATAAAAATGTTAATGAGTCCTCTACTTCCTTTAATGCTAAA
ACTAACAATGAGCATGCTGTCAAAGAGGTAAAGGAAGAATCCTCTTTATC
TAGGGAGGCCTCTCAAGATTTTGATGATGTAGATGCTGATTCTCATCATG
CTGGTTCTCTTAGTCATAAATCTGGAAAAAACTTACGGTCAAGTCCAAAG
AAAAAGCCAAGGCGCCGAAAATTTTCAGGTTCTTGTGAGATGAAATTAAT
GAATTCAACACACCTTGTGGAGCCTGTAGAAAGTCGGAAGTTTGCTCGAT
TTTCCTTACAGTATAAACAAATGGAAGAGAAGCCTGAAGGAGAAGACCAA
TGGGTACCTAGATTTGCCGGGCATCAGAATTTACAAGAACGTGAGGAATC
TTTTTTCGCACGTGACCAAAAGATAAATTGTGGGTTTGTTAAAGGTCCAC
AAGGATATCCAAGCACTGGCTTTGATCTGGCAGAAGATGATGTGAATTAT
ATCAGCAGGTGCCACATTGCTGTCATATCTTGCATTTTCGGAAATTCTGA
TCGCTTGAGGACACCTGCTGGCAAAATGGTTACTCGTTCGTCAAGGAAAA
ATGTCTGCTTTGTTATGTTTGTGGATGAAGCTACGATGCAAACACTTTAT
TCAGAAGGTCAAACACCTGATGGTGGTTTTATTGGTTTATGGAAGATAGT
GGTTGTAAAGAATCTTCCTTACACTGATATGCGTAGGGTGGGAAAAATAC
CAAAACTGTTACCGCATCGACTATTTCCTTTTGCAAGGTACTCAATCTGG
TTAGATAGCAAACTACGTCTACAGCGTGACCCCTTACAACTCCTGGATTA
CTTCTTGTGGCGAAAAGGTCATGAGTATGCCATTTCTAATCACTATGATC
GTCATTGTGTCTGGGAAGAGGTTGCGCAAAATAAGAAGCTGAACAAGTAT
AATCATACAGTCATTGATGAGCAATTTGATTTCTATCAGGCTGATGGACT
GAAAAGATTCGATGCTTCAGATCCTAACAAGCTTCTTCCTAGCAATGTGC
CTGAAGGTTCATTTATTGTTAGAGCACACACCCCGATGTCAAATTTGTTT
TCATGTCTTTGGTTCAATGAGGTTGAGCGGTTTACTCCCCGTGATCAGCT
AAGTTTTGCATATACATACCAGAAATTGCGAAGAACAAATCCTGACAAAC
CCTTTTATCTGAACATGTTCAAGGATTGTGAGAGGAGAGCCGTAGCTAAG
TTGTTTCGACATAGATCGGATGAGAAGCGATATATTCAGCAACGGGCAAC
ATTGTAAAATGTATGTTGTATTATCAAACCTTTTCTGTTGAATATAAAAA
GAATTATTTTTTGTACACTTTCCTTGGCCATGCTGGTTCATAAAGAAAGG
ATCAGAGTTGCATCGGTGGTGATGGTTGTTGACATAGAATGATGGACGTC
GAGGGAACAAAGTTTGTCGAGCATGGTGGAGGTATCTTGGTTGGGGGGGA
AAGTCCATTGGCTTTAATTTGCTAGAAAAATTCTGTTTTGCATAATTGTT
ATTTGTTCTTTTGTTCACATTGATTGCTTCGTCCATAGGTAAAAACGGAG
GACCAATACTAATGTACTTCTTACAACTAAAATTTGTTGTATTATTGCTA
TTACTATTATCATCATTTTTTGAACCTTTCAATTGGCTATTGAAGTTTTA
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR006852DUF616