g.arboreum_cottongen_reftransV1_0001616, g.arboreum_cottongen_reftransV1_0001616 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0001616
Unique Nameg.arboreum_cottongen_reftransV1_0001616
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2623
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr9chromosomeg.arboreum_cottongen_reftransV1_0001616:1..2623 .
Chr9:66114766..66144330 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: A0A0D2TGG1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G092400 PE=4 SV=1)

HSP 1 Score: 1513.43 bits (3917), Expect = 0.000e+0
Identity = 754/768 (98.18%), Postives = 763/768 (99.35%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQDSPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAK+LEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVD PV LFWISLQGKLSQIGSDSLEKDMLEKNKC+MLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLET IFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKF+AETGVDD TYDEKKTALFR+QGTGPENMQAIQVDHVSSSLNSSYCYILQSGTS+FTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEEL LEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTS+GTAPSRNALKPRSR+ATPDGLRSRSSSSNGWERSFSPASTVSGSHLKFSDNYS+SSPTPVARKLFTGSSPYQDSPV+EPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF
Sbjct:  134 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETSIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFVAETGVDDYTYDEKKTALFRVQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSVFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELSLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSSGTAPSRNALKPRSREATPDGLRSRSSSSNGWERSFSPASTVSGSHLKFSDNYSVSSPTPVARKLFTGSSPYQDSPVIEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 901          

HSP 2 Score: 67.0106 bits (162), Expect = 5.013e-8
Identity = 83/350 (23.71%), Postives = 150/350 (42.86%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYT----YPGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETG-VDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINP-----AWQPISVREG-----SEPDSFWSSLGGKTEYPREKEM--KKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKA 1758
            L++W +    L  +P S   K YSG  Y+V  T       T+ D    + WLG  +   D A   D    +DA + S     V  +  Q +E  +F   F+  I+   G+      F  + G ++ DTY   +  L   +G    +++  +V    SSLN +  +IL + + IF + G  +S ++      +++ I         +  ++ +G     S+   FWS  GG    PR+  +   + ++ P +  +   +G        S  +D L      +LDC  E++VW+GR++ I  ++ +++    FL+    ++E      +  +TEG E   F  +F   P  A
Sbjct:   21 LEIWCIEKLRLVPVPKSSIGKFYSGSAYVVLSTSVLKSGPTQHD---IHYWLGNDANEVDSALASDKALELDAALGSC---AVQYREVQGQETEKFLSYFKPCIIPVEGV------FTTQEGALNGDTY---QVTLLTCKGDHVAHVK--EVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLR----KQERSNGTHLTFLTEGLETSIFKSYFNSWPQTA 349          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: A0A061GZW4_THECC (Villin-like 1 OS=Theobroma cacao GN=TCM_041634 PE=4 SV=1)

HSP 1 Score: 1377.07 bits (3563), Expect = 0.000e+0
Identity = 679/768 (88.41%), Postives = 722/768 (94.01%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQDSPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            G+T QVTLLTCKGDHV HVKEVPFSRSSLNHNDVFIL+TASKIFLF GCNSSIQERAKALEVVQYIKENKH+G CEVA IEDGKLVGDSDVGEFWS FGGYAPIPRDSAL G QQVD PV LFWI+LQGKLSQIGS+SL+KDMLEK+KC+MLDCGAE+FVWMGRNT ITERKTSISAAEDFLRK +RS+ THLTFLTEGLET +FKSYFN WPQTAETKLYDEGREKVAAIFK QGYEVKELPEED QSYINCRGTLKVWRVNGHELSL+P SEQTKLYSGDCY+VQYTYPG ERDESLFYAWLG  SVLEDRADA+FHM AIVDS RGDPVMAQ+ +N+EP+QFFLIFQTLIVYKGGISAGYKKFIAE+G+DDDTYDEKKTALFR+QGT PENMQAIQVDHVSSSLNSSYCYILQ+GTS+FTWIGNLT S+DHDLLDRM+ELINP WQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIED HLFKFT TEGD KVKEIYSFTQDDLTTEDVLVLDCHKEIYVW+GRHSTIKSKQ ALNLGLKFL+T+ILEEEL LE PIYV+TEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTS+GTAP+RNA K  SR+ATPDG RSRS SSNGWERS SPAS+ SGSHLKFSDN+++SSPTP+ RKLFTGSSPYQDSPVV+PSSPSTNENS+QID  ETSAN+LIYPYQRLTV ST+PV GIDVTKREAYLSEEEFAE+ GMPKGAFYKLPKWRQNKLKMAVDLF
Sbjct:  134 GETNQVTLLTCKGDHVVHVKEVPFSRSSLNHNDVFILETASKIFLFSGCNSSIQERAKALEVVQYIKENKHAGNCEVAIIEDGKLVGDSDVGEFWSFFGGYAPIPRDSALAGEQQVDSPVILFWINLQGKLSQIGSNSLDKDMLEKSKCYMLDCGAEIFVWMGRNTSITERKTSISAAEDFLRKHDRSSRTHLTFLTEGLETSMFKSYFNIWPQTAETKLYDEGREKVAAIFKQQGYEVKELPEEDFQSYINCRGTLKVWRVNGHELSLIPVSEQTKLYSGDCYVVQYTYPGNERDESLFYAWLGHRSVLEDRADAIFHMSAIVDSTRGDPVMAQVTENREPVQFFLIFQTLIVYKGGISAGYKKFIAESGIDDDTYDEKKTALFRVQGTSPENMQAIQVDHVSSSLNSSYCYILQNGTSVFTWIGNLTLSRDHDLLDRMLELINPTWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDQHLFKFTSTEGDVKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWVGRHSTIKSKQVALNLGLKFLETDILEEELSLETPIYVITEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSSGTAPARNARKAYSREATPDGPRSRSGSSNGWERSVSPASSKSGSHLKFSDNHNVSSPTPIVRKLFTGSSPYQDSPVVKPSSPSTNENSNQIDTIETSANALIYPYQRLTVVSTDPVPGIDVTKREAYLSEEEFAERFGMPKGAFYKLPKWRQNKLKMAVDLF 901          

HSP 2 Score: 65.0846 bits (157), Expect = 2.269e-7
Identity = 82/363 (22.59%), Postives = 155/363 (42.70%), Query Frame = 1
Query:  733 EDVQSYINCRGT---LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTY---PGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQP----ISVRE------GSEPDSFWSSLGGKTEYPREKEM--KKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKA 1758
            +DV S ++  G    L++W +    L  +P S   K YSG  Y+V  T     G  + +   + W+G  +   D A   D    +DA + S     V  +  Q +E  +F   F+  I+   G+      + ++ G  +   +  +  L   +G    +++  +V    SSLN +  +IL++ + IF + G  +S ++      +++ I          +++ E       S+   FWS  GG    PR+  +  ++ ++ P +  +   +G        S  +D L      +LDC  EI+VW+GR+++I  ++ +++    FL+ +       L      +TEG E   F  +F   P  A
Sbjct:    6 KDVDSALHGAGAKPGLEIWCIEDLRLVPVPKSSHGKFYSGSAYVVLSTSVLKSGPPQHD--IHYWMGNDANEVDSALASDKALQLDAALGSCT---VQYREVQGQETEKFLSYFKPCIIPVEGV------YSSQPG--NSNGETNQVTLLTCKGDHVVHVK--EVPFSRSSLNHNDVFILETASKIFLFSGCNSSIQERAKALEVVQYIKENKHAGNCEVAIIEDGKLVGDSDVGEFWSFFGGYAPIPRDSALAGEQQVDSPVILFWINLQGKLSQIGSNSLDKDMLEKSKCYMLDCGAEIFVWMGRNTSITERKTSISAAEDFLRKHDRSSRTHLT----FLTEGLETSMFKSYFNIWPQTA 349          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: A0A0D2RX03_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G092400 PE=4 SV=1)

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 597/608 (98.19%), Postives = 603/608 (99.18%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGT 1824
            GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAK+LEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVD PV LFWISLQGKLSQIGSDSLEKDMLEKNKC+MLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLET IFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKF+AETGVDD TYDEKKTALFR+QGTGPENMQAIQVDHVSSSLNSSYCYILQSGTS+FTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEEL LEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTS+GT
Sbjct:  134 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETSIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFVAETGVDDYTYDEKKTALFRVQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSVFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELSLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSSGT 741          

HSP 2 Score: 66.2402 bits (160), Expect = 7.432e-8
Identity = 82/349 (23.50%), Postives = 149/349 (42.69%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYT----YPGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREG-----SEPDSFWSSLGGKTEYPREKEM--KKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKA 1758
            L++W +    L  +P S   K YSG  Y+V  T       T+ D    + WLG  +   D A   D    +DA + S     V  +  Q +E  +F   F+  I+   G+         E  ++ DTY   +  L   +G    +++  +V    SSLN +  +IL + + IF + G  +S ++      +++ I     +   +  ++ +G     S+   FWS  GG    PR+  +   + ++ P +  +   +G        S  +D L      +LDC  E++VW+GR++ I  ++ +++    FL+    ++E      +  +TEG E   F  +F   P  A
Sbjct:   21 LEIWCIEKLRLVPVPKSSIGKFYSGSAYVVLSTSVLKSGPTQHD---IHYWLGNDANEVDSALASDKALELDAALGSC---AVQYREVQGQETEKFLSYFKPCIIPVEGVFT-----TQEGALNGDTY---QVTLLTCKGDHVAHVK--EVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLR----KQERSNGTHLTFLTEGLETSIFKSYFNSWPQTA 349          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: A0A0D2UIS3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G092400 PE=4 SV=1)

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 597/609 (98.03%), Postives = 603/609 (99.01%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTA 1827
            GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAK+LEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVD PV LFWISLQGKLSQIGSDSLEKDMLEKNKC+MLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLET IFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKF+AETGVDD TYDEKKTALFR+QGTGPENMQAIQVDHVSSSLNSSYCYILQSGTS+FTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEEL LEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTS+GT 
Sbjct:  134 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETSIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFVAETGVDDYTYDEKKTALFRVQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSVFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQDDLTTEDVLVLDCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELSLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSSGTV 742          

HSP 2 Score: 66.6254 bits (161), Expect = 7.185e-8
Identity = 82/349 (23.50%), Postives = 149/349 (42.69%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYT----YPGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREG-----SEPDSFWSSLGGKTEYPREKEM--KKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKA 1758
            L++W +    L  +P S   K YSG  Y+V  T       T+ D    + WLG  +   D A   D    +DA + S     V  +  Q +E  +F   F+  I+   G+         E  ++ DTY   +  L   +G    +++  +V    SSLN +  +IL + + IF + G  +S ++      +++ I     +   +  ++ +G     S+   FWS  GG    PR+  +   + ++ P +  +   +G        S  +D L      +LDC  E++VW+GR++ I  ++ +++    FL+    ++E      +  +TEG E   F  +F   P  A
Sbjct:   21 LEIWCIEKLRLVPVPKSSIGKFYSGSAYVVLSTSVLKSGPTQHD---IHYWLGNDANEVDSALASDKALELDAALGSC---AVQYREVQGQETEKFLSYFKPCIIPVEGVFT-----TQEGALNGDTY---QVTLLTCKGDHVAHVK--EVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKSLEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDSPVILFWISLQGKLSQIGSDSLEKDMLEKNKCYMLDCGAEVFVWMGRNTLITERKTSISAAEDFLR----KQERSNGTHLTFLTEGLETSIFKSYFNSWPQTA 349          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: V4RUE1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10027779mg PE=4 SV=1)

HSP 1 Score: 1079.7 bits (2791), Expect = 0.000e+0
Identity = 546/769 (71.00%), Postives = 629/769 (81.79%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRP-VTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQDSPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            G+TY++++LTCKGDHV  VKEVPFSRSSLNHNDVFI+DTASKIFLF GCNSSIQERAKALEVVQYIKE+KH GKCEVAT+EDGK VGDSDVGEFWSLFGGYAPIPRDS     QQ D P  T FWI+LQGKL QI ++SL KDMLEK+KC+MLDC  EVFVWMGRNT ITER+ SISA+EDFLR Q R+ GTHLTFLTEGLET +F+SYF+SWPQ AE KLYDEGREKVAAIFK QG++VKELPEED + Y+NCRG LKVWRVNG ELSLLPA+EQ KL+SGDCYIV+YTYPG  RDE++ YAW G  S+ EDRA A+ HM AIVDS RG+ VMAQ+ Q+ EP+QFFLIFQ+LIV+KGG+SA YKKFI E G+  +TYDEKKTALFRIQGT P NMQA QVD VS+ LNSSYCYILQ+G S+FTWIGNL+SS+DHDLLDRM+ELINP WQPISVREGSEP+ FW++LGGK+EYPREKE+K FIEDPHLF  T T+GD KVKEIY+FTQDDLTTED+LVLDC +EIYVWIG HS + S+Q+ALN+G KFL+T+IL E L LE PIYVVTEGHEPPFFTCFF WDP KA MHGNSFERKLA LKG+ S   A  RN+ KP   + TPD LRSRS SSNG + S SP  ++S S L  +D +     TP A+ LF+ S+  +DS   EPSS S +  + Q + +E   +SLIY Y++L V S  PV GIDVTKREAYL EEEF EK  M K  FY+LPKW+QNK KM++ LF
Sbjct:  134 GETYKISMLTCKGDHVVRVKEVPFSRSSLNHNDVFIVDTASKIFLFSGCNSSIQERAKALEVVQYIKEDKHGGKCEVATVEDGKFVGDSDVGEFWSLFGGYAPIPRDSPSAFQQQPDTPSTTFFWINLQGKLCQIAANSLNKDMLEKDKCYMLDCVNEVFVWMGRNTSITERRISISASEDFLRNQGRTTGTHLTFLTEGLETTVFRSYFDSWPQIAEPKLYDEGREKVAAIFKQQGHDVKELPEEDFEPYVNCRGILKVWRVNGDELSLLPAAEQMKLFSGDCYIVKYTYPGNGRDENVIYAWFGHESMTEDRAAAISHMSAIVDSTRGEAVMAQVHQDMEPVQFFLIFQSLIVFKGGLSAQYKKFIVEEGIVGETYDEKKTALFRIQGTSPSNMQAFQVDRVSTCLNSSYCYILQNGASVFTWIGNLSSSRDHDLLDRMVELINPTWQPISVREGSEPEVFWNALGGKSEYPREKEIKGFIEDPHLFTCTLTKGDLKVKEIYNFTQDDLTTEDILVLDCCREIYVWIGCHSDLNSRQQALNIGQKFLETDILVEGLSLETPIYVVTEGHEPPFFTCFFTWDPLKAKMHGNSFERKLAILKGRPSI-EASVRNSWKPYFGETTPDSLRSRSVSSNGLQGSGSPIPSISSSKLNSADRHRAFCETPTAQLLFSESTLDKDSLTGEPSSSSKSTKAIQFNESEAGVSSLIYSYEQLRVDSRNPVIGIDVTKREAYLPEEEFQEKFKMTKRTFYELPKWKQNKFKMSLHLF 901          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: D7SJY9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0004g06500 PE=4 SV=1)

HSP 1 Score: 1064.68 bits (2752), Expect = 0.000e+0
Identity = 541/779 (69.45%), Postives = 626/779 (80.36%), Query Frame = 1
Query:    4 DTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRP-VTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQD----SPV------VEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPV-SGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            +TYQ++L TCKGDHV H+KEVPFSRSSLNHNDVFILDTASKIFLF GCNSSIQERAKALEVVQYIKENKH+GKCEVATIEDGK VGD DVGEFW LFGGYAPIPRD      +Q D P   LFWI+ QGKL Q   + L K+MLE NKC+MLDC  E+FVWMGRNT ITERKTSISAAEDFL+ Q RS  +HLT LTEG ET IF+SYF+ WPQ AE +LY+EGR KVAA+FK QGY+VKELPEED  S I+C GTLKVWRVN  EL L+P +EQTKL+SGDCYIVQY YPG  RDE LFYAWLG+G+V+EDR DA+  M+ IVDS +GD V+ Q+ + KEP++FFLIFQTLIV+KGG+S  YK+FIAE G+ D+TYDEKKTALFR+QGT P NMQAIQVD VSSSLNSSYC+ILQ+ TSIFTW+GNL+S++DHDLLDRM++LINP  QPISVREGSEPD FW +LGGK E+PRE+E+K ++EDPHLF  T T+GD KVKEI++FTQDDLTTED L+LDC++EIYVW G HS ++SK++AL +GLKFL+ +IL E L LE PIYVVTEGHEP FFT FFEWD SKANMHG+SFER+LA LKG       P RN+ K  S + TPD LRSRS SSNG  RS S A +VSGS+LK SDN+ ISS +P+AR LF+GS P  D    SPV      V PSSPS N    QID  +   N LI+PY+RL V + +PV +GIDVTKREAYLSEEEF +  GM K AFYKLPKWRQNKLK +V LF
Sbjct:  130 ETYQISLFTCKGDHVVHIKEVPFSRSSLNHNDVFILDTASKIFLFSGCNSSIQERAKALEVVQYIKENKHNGKCEVATIEDGKFVGDPDVGEFWGLFGGYAPIPRDIPPSLQKQPDIPNAKLFWIATQGKLCQTVCNMLNKEMLESNKCYMLDCDNEIFVWMGRNTSITERKTSISAAEDFLKSQGRSTRSHLTSLTEGSETAIFRSYFDVWPQLAEPRLYEEGRGKVAAMFKQQGYDVKELPEEDCDSLIDCSGTLKVWRVNDDELFLVPVAEQTKLFSGDCYIVQYKYPGNGRDEYLFYAWLGRGAVMEDRVDAISRMNTIVDSMKGDSVVGQVIEEKEPIEFFLIFQTLIVFKGGLSTRYKRFIAEKGIADETYDEKKTALFRVQGTSPNNMQAIQVDQVSSSLNSSYCFILQTETSIFTWVGNLSSTRDHDLLDRMLDLINPTLQPISVREGSEPDVFWKALGGKAEHPREREIKAYVEDPHLFTCTFTDGDLKVKEIFNFTQDDLTTEDKLILDCNREIYVWCGCHSNVRSKKQALEIGLKFLEIDILVEGLSLETPIYVVTEGHEPTFFTRFFEWDSSKANMHGSSFERRLAILKGTAQKIEVPLRNSWKACSTENTPDSLRSRSVSSNGLRRSASSAFSVSGSNLKSSDNHQISSVSPIARSLFSGSYPDHDSADGSPVPPRPTAVVPSSPSENVGLDQIDGVKIDVNLLIFPYERLKVVADDPVTTGIDVTKREAYLSEEEFQQIFGMTKTAFYKLPKWRQNKLKRSVHLF 908          

HSP 2 Score: 69.707 bits (169), Expect = 7.436e-9
Identity = 84/352 (23.86%), Postives = 153/352 (43.47%), Query Frame = 1
Query:  760 RGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYT-YPGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIV-YKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREG---SEPD--SFWSSLGGKTEYPRE----KEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKA 1758
            +  L++W +    L L+P S   K +SG  YI+  T    +   +   + WLG  +   D A   D    +DA + S     V  +  Q  E  +F   F+  I+  +G  S+G  +   ET          + +LF  +G    +++  +V    SSLN +  +IL + + IF + G  +S ++      +++ I     N   +  ++ +G    +PD   FW   GG    PR+     + +  I +  LF +  T+G           ++ L +    +LDC  EI+VW+GR+++I  ++ +++    FL++        L +    +TEG E   F  +F+  P  A
Sbjct:   13 KAGLEIWCIENLRLVLVPKSSYGKFFSGSAYIILNTVLLKSSSPQHDIHYWLGNDAKEVDSALASDKALELDAALGS---QAVQFREIQGLETEKFLSYFKPCIIPIEGVFSSGPGELNCET---------YQISLFTCKGDHVVHIK--EVPFSRSSLNHNDVFILDTASKIFLFSGCNSSIQERAKALEVVQYIKENKHNGKCEVATIEDGKFVGDPDVGEFWGLFGGYAPIPRDIPPSLQKQPDIPNAKLF-WIATQGKLCQTVCNMLNKEMLESNKCYMLDCDNEIFVWMGRNTSITERKTSISAAEDFLKSQGRSTRSHLTS----LTEGSETAIFRSYFDVWPQLA 345          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: B9HP49_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s04960g PE=4 SV=1)

HSP 1 Score: 1061.21 bits (2743), Expect = 0.000e+0
Identity = 532/774 (68.73%), Postives = 617/774 (79.72%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVT-LFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELP-EEDVQSYINCRGTLKV-WRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQD---SPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            G++Y+++LLTCKG+HV  VKEVPFSRSSLNHNDVFILDTASKIFLF GCNSS QERAKALEVVQYIKENKH G CEVAT+EDGKLVGD +VGEFWS FGGYAPIPRDS     +Q D P + LFWI+ Q KL      SL K+MLE NKC+MLDCGAE+FVWMGRNT ITERK SIS  ED LR Q RS  THLTFLTEGLET IF+SYF +WPQ  E KLY+EGR KVAAIFK QGY+VKELP EED Q YINCRG LKV WR+NG + +L+P  EQTKL+SGDCYIVQYTYPG  RDE LFYAWLG+ SVL+DRADA+ HM+AI DS++ DPV+ Q+ Q+KEPL FF IFQT+I++KGG+S  YK  IAE G+ D+TYDE+KTALFR+QG  PENMQAIQVD VS+SLNSSYCYILQ+GTSIFTWIGNL+S+ DH LLDRM+ELINP WQPISVREGSEPD FW++LGGKTEYPR+KE+K+ +EDPHLF  TC +GDFKVKEIY+F QDDLTTEDVL+LDCH+EI+VWIG HS +KSKQ+A+ LG+KFLQT+ L E L  E PIYV+TEG EP FFT FFEWD SKANMHGNSFER+LA LKGK       +  + K  S++ TPDGL    S S+    S SP S+ S +H   S N  IS+P P ARKLF G SP+ D   SP  E  SPS      Q+D N+ S NS+IYPY+RL V+S++PV+ IDVTKRE YL +EEF EK GM K AFY+LPKWRQNKLK+++ LF
Sbjct:  132 GESYKISLLTCKGEHVVSVKEVPFSRSSLNHNDVFILDTASKIFLFSGCNSSTQERAKALEVVQYIKENKHGGTCEVATVEDGKLVGDPEVGEFWSFFGGYAPIPRDSPCV-EKQSDSPFSQLFWITAQAKLCPCEGSSLNKEMLETNKCYMLDCGAEIFVWMGRNTSITERKKSISVTEDLLRNQGRSMATHLTFLTEGLETSIFRSYFKNWPQVVEPKLYEEGRGKVAAIFKQQGYDVKELPDEEDCQPYINCRGKLKVVWRINGEQPTLIPDPEQTKLFSGDCYIVQYTYPGNGRDEHLFYAWLGRDSVLDDRADAISHMNAIADSSKRDPVLVQVIQDKEPLLFFSIFQTVIIFKGGLSKRYKNLIAEKGILDETYDEQKTALFRVQGISPENMQAIQVDQVSNSLNSSYCYILQTGTSIFTWIGNLSSTVDHALLDRMLELINPTWQPISVREGSEPDIFWNALGGKTEYPRQKELKQHVEDPHLFTLTCADGDFKVKEIYNFAQDDLTTEDVLILDCHEEIHVWIGSHSNVKSKQQAILLGMKFLQTDPLVEGLSSETPIYVITEGREPLFFTRFFEWDSSKANMHGNSFERRLAILKGKKQNLEVHTSKSWKASSKETTPDGL-RSKSVSSNGRNSTSPVSSASVTHFNSSTNCQISTPAPTARKLFPG-SPFHDSAGSPKAEAESPSQAAVLSQVDGNDASENSVIYPYERLKVNSSDPVTDIDVTKREGYLCDEEFQEKFGMRKKAFYELPKWRQNKLKISLHLF 902          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: M5W752_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa001117mg PE=4 SV=1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 532/775 (68.65%), Postives = 621/775 (80.13%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRP-VTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELP-EEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQD--SPVVEPSSPSTNENSHQIDAN---ETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            G+TY+V+LL CKGDHV HVKEVPFSRSSLNH+DVFILDTASKIFLF GCNSSIQERAKALEVVQYIKENKH   CEVAT+EDGK VGD +VGEFWSLFGGYAPIP+D      +Q D P V L WIS QGKL    +DSL K+MLE +KC+M+DC +E+FVWMG++T +TERKTSISAAEDFLR Q RS GTH TF+TEGLE   F+SYF +WPQT ETKLY+EGR KVAA+FK QGYEVKELP EED+Q +I+CRGTLKVWRV+  +LSLLPASE+ K++SGDCY+VQYTY G ER E+LFYAWLG GSV+EDR DA+ H++AIVDS RG+PV+AQ+ + KEP QFF IFQTLI++KGG+S  YKKFIAE G+ D+TYDE KTALFR+QGT P NMQAIQVD VS SLNSSYCYILQ+GTS FTWIGNL+S++DHDLLDRM+ELI P WQ  SVREGSE D FW++LGGK +Y R KE+K +IEDPHLF  + TEGDFKVKEIY+FTQDDLTTEDVLVLDCH EI+VWIG HS ++SKQ+AL LGLKFL+T++L E L LE PIYV++EGHEPPFFT FFEWD  K+NM GNSFERKLA LKGK     AP RN+ K  SR+ TPDGLRS+S +SNG       AS VS S +  S+N+ + S TP+ RK+FTGSSP     SP  E   P+T     Q D N   E   N LIYPY+RL V S +PV+GID+TKREAYL++EEF  +  M K  FYKL KW+QNKLKMA+ LF
Sbjct:  134 GETYKVSLLACKGDHVVHVKEVPFSRSSLNHSDVFILDTASKIFLFSGCNSSIQERAKALEVVQYIKENKHRANCEVATVEDGKFVGDPEVGEFWSLFGGYAPIPQDPPSSVQKQPDTPFVKLSWISTQGKLHACQTDSLSKEMLETDKCYMVDCDSEIFVWMGKHTSVTERKTSISAAEDFLRNQGRSAGTHSTFITEGLEPAKFRSYFYNWPQTVETKLYEEGRGKVAAMFKQQGYEVKELPDEEDIQPFIDCRGTLKVWRVDCEKLSLLPASEERKIFSGDCYVVQYTYLGNERSENLFYAWLGCGSVMEDRKDAMSHLNAIVDSTRGNPVLAQVMEKKEPSQFFSIFQTLIIFKGGMSTRYKKFIAEKGIGDETYDESKTALFRVQGTSPNNMQAIQVDPVSGSLNSSYCYILQTGTSAFTWIGNLSSTRDHDLLDRMLELIIPTWQATSVREGSESDIFWNALGGKADYARAKEIKGYIEDPHLFMLSTTEGDFKVKEIYNFTQDDLTTEDVLVLDCHTEIHVWIGCHSNVRSKQQALTLGLKFLETDVLVEGLSLETPIYVISEGHEPPFFTRFFEWDSLKSNMLGNSFERKLAILKGKPQQLEAPKRNSWKAYSRETTPDGLRSKSMTSNGQRSVSP-ASGVSVSSVTSSNNHILFSSTPINRKIFTGSSPNGSPGSPAAEAKLPAT--GGTQADGNEPREAGTNLLIYPYERLKVISKDPVAGIDITKREAYLADEEFQAQFAMTKRDFYKLAKWKQNKLKMALHLF 905          

HSP 2 Score: 75.485 bits (184), Expect = 1.448e-10
Identity = 81/340 (23.82%), Postives = 153/340 (45.00%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYT-YPGTERDESLFYAWLGQGSVLEDRA---DAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREGS-----EPDSFWSSLGGKTEYPRE--KEMKKFIEDPHL-FKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF 1737
            L++W V   +L  +P S   + YSG  Y++  T  P +   +   + WLG  +   D A   D    +DA + S     V  +  Q +E  +F   F+  I+   G+ A  K+ +     + +TY   K +L   +G    +++  +V    SSLN S  +IL + + IF + G  +S ++      +++ I         +  +V +G      E   FWS  GG    P++    ++K  + P +   +  T+G     +  S +++ L T+   ++DC  EI+VW+G+H+++  ++ +++    FL+     +          +TEG EP  F  +F
Sbjct:   21 LEIWCVENLKLVSVPKSSHGRFYSGSAYVILNTVLPKSGLPQHDIHYWLGHDTNKVDSALASDKALELDAALGSCT---VQYRELQGQETGKFLSYFKPCIIPIEGVYASQKEHL-----NGETY---KVSLLACKGDHVVHVK--EVPFSRSSLNHSDVFILDTASKIFLFSGCNSSIQERAKALEVVQYIKENKHRANCEVATVEDGKFVGDPEVGEFWSLFGGYAPIPQDPPSSVQKQPDTPFVKLSWISTQGKLHACQTDSLSKEMLETDKCYMVDCDSEIFVWMGKHTSVTERKTSISAAEDFLRN----QGRSAGTHSTFITEGLEPAKFRSYF 343          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: B9SI12_RICCO (Villin 1-4, putative OS=Ricinus communis GN=RCOM_0612050 PE=4 SV=1)

HSP 1 Score: 1035.79 bits (2677), Expect = 0.000e+0
Identity = 534/773 (69.08%), Postives = 619/773 (80.08%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRP-VTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDV-QSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQ---DSPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            GD+Y+V LL CKGDHV  VKEVPFSRSSLNHNDVF+LDTASKIFLFCGCNSSIQERAKALEVVQYIKENKH GKC+V TIEDGK VGDSDVGEFWSLFGGYAPIP+DS  G  +  + P V LFWI+ QGKL     +SL K+ML+ NKC+MLDCGAE FVWMGRNT ITERKTSIS  EDFLR + RS  T+LTFLTEGLET IF+SYF SWPQ  E KLY+EGR KVAA+FK QG++VKELP+++V Q YINC+G LKVW VNG EL LLP  +Q KL+SGDCY++QYTY G ERDE+L YAWLG+ S+ +DR DA+ H++AI DS +GDPV+AQ+  +KEPLQ FLIFQT+I++KGG+S  YK+FI+E G+ D+TYDE KTALFR+QGT P +MQAIQVD VSSSLNSSYCYILQ+GTS FTWIGNL+S+ D DLLDRM+ELINP WQPISVREGSEPD FW  LGGKTEYP+ K +K+ IEDP+LF F  T+ DFKVKEIYSFTQDDLTTEDVL+L+CH+EIYVWIG HS +KSKQ+AL LG KFL+T    E L LE PIYVVTEG EP FFT FFEWD  KANMHGNSFERKLA LKGK      P RN+ K  SR+ATPD LRS    +NG   S  PAS+VSGS+ K S N+ +SSP P+ARKLF  +SP Q    SP  E  SP  N N  Q+D +  S N+LIYPY RL V S++P + IDV+KREAYLS+EEF EK  M +GAFYKL KWRQNKLK++++LF
Sbjct:  134 GDSYRVKLLKCKGDHVVSVKEVPFSRSSLNHNDVFVLDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHGGKCDVVTIEDGKFVGDSDVGEFWSLFGGYAPIPKDSPSGVVKDTETPSVQLFWITTQGKLCPKEGNSLNKEMLDSNKCYMLDCGAETFVWMGRNTSITERKTSISVIEDFLRNEGRSTETYLTFLTEGLETPIFRSYFESWPQM-EPKLYEEGRGKVAAMFKQQGFDVKELPDDEVFQPYINCQGKLKVWWVNGDELILLPVQKQIKLFSGDCYVIQYTYTGDERDENLLYAWLGRESIQDDRVDAISHINAIADSTKGDPVLAQVFGDKEPLQLFLIFQTVIIFKGGLSKRYKRFISENGILDETYDEGKTALFRVQGTSPNSMQAIQVDQVSSSLNSSYCYILQTGTSTFTWIGNLSSTIDRDLLDRMLELINPMWQPISVREGSEPDIFWEELGGKTEYPKGKAIKQHIEDPYLFAFMFTDDDFKVKEIYSFTQDDLTTEDVLILNCHEEIYVWIGGHSNVKSKQQALRLGQKFLETVHPVEGLSLETPIYVVTEGWEPTFFTRFFEWDSLKANMHGNSFERKLALLKGKKQNLEVPIRNSRKVSSREATPDDLRSNYVRTNGRGSSLPPASSVSGSNSKSSYNHLVSSPAPIARKLFL-TSPSQASSGSPTAEARSPG-NVNLVQVDGSNGSVNTLIYPYMRLKVDSSDPATDIDVSKREAYLSDEEFQEKFQMTRGAFYKLAKWRQNKLKLSLNLF 903          

HSP 2 Score: 72.0182 bits (175), Expect = 1.665e-9
Identity = 86/344 (25.00%), Postives = 155/344 (45.06%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTY---PGTERDESLFYAWLGQGSV-LED--RADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINP-----AWQPISVREG-----SEPDSFWSSLGGKTEYPREKE--MKKFIEDP--HLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFE 1740
            L++W V    L  +P S   K YSG+ YIV  T     G  + +   + W+G  +  LE    +D    +DA + S     V  +  Q +E  +F   F+  I+   G+     +      ++ D+Y   +  L + +G    +++  +V    SSLN +  ++L + + IF + G  +S ++      +++ I           +++ +G     S+   FWS  GG    P++    + K  E P   LF  T T+G    KE  S  ++ L +    +LDC  E +VW+GR+++I  ++ ++++   FL+      E +L      +TEG E P F  +FE
Sbjct:   21 LEIWCVENLRLVPVPKSLHGKFYSGNAYIVLNTVLLKNGPPQHD--IHYWIGNNATELESVLASDKALELDAALGSCT---VQYREVQGQETEKFLSHFKPCIIPVEGVYLSQPE-----KLNGDSY---RVKLLKCKGDHVVSVK--EVPFSRSSLNHNDVFVLDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHGGKCDVVTIEDGKFVGDSDVGEFWSLFGGYAPIPKDSPSGVVKDTETPSVQLFWIT-TQGKLCPKEGNSLNKEMLDSNKCYMLDCGAETFVWMGRNTSITERKTSISVIEDFLRNEGRSTETYLT----FLTEGLETPIFRSYFE 344          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Match: A0A067FUI7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g002853mg PE=4 SV=1)

HSP 1 Score: 1022.31 bits (2642), Expect = 0.000e+0
Identity = 520/733 (70.94%), Postives = 597/733 (81.45%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRP-VTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLFTGSSPYQDSPVVEPSSPSTNENSHQIDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREA 2196
            G+TY++++LTCKGDHV  VKEVPFSRSSLNHNDVFI+DTASKIFLF GCNSSIQERAKALEVVQYIKE+KH GKC VAT+EDGK VGDSDVGEFWSLFGGYAPIPRDS     QQ D P  T FWI+LQGKL QI ++SL KDMLEK+KC+MLDC  EVFVW GRNT ITER+ SISA+EDFLR Q R+ GTHLTFLTEGLET +F+SYF+SWPQ AE KLYDEGREKVAAIFK QG++VKELPEED + Y+NCRG LKVWRVNG ELSLLPA+EQ KL+SGDCYIV+YTYPG  RDE++ YAW G  S+ EDRA A+ HM AIVDS RG+ VMAQ+ Q+ EP+QFFLIFQ+LIV+KGG+S  YKKFI E G+ D+TYDEKK ALF IQGT P NMQA QVD VS+ LNSSYCYILQ+G S+FTWIGNL+SS+DHDLLDRM+ELINP WQPISVREGSEP+ FW++LGGK+EYPREKE+K FIEDPHLF  T TEGD KVKEIY+FTQDDLTTED+LVLDC +EIYVWIG HS + SKQ+ALN+G KFL+T+IL E L LE PIYVVTEGHEPPFFTCFF WDP KA MHGNSFERKLA LKG+ S   A  RN+ KP   + TPD LRSRS SSNG + S SP  ++S S L  +D +     TP A+ LF+ S+  +DS   EPSS S +  + Q + +E   +SLIY Y++L V S  PV GIDVTKRE 
Sbjct:  134 GETYKISMLTCKGDHVVRVKEVPFSRSSLNHNDVFIVDTASKIFLFSGCNSSIQERAKALEVVQYIKEDKHGGKCGVATVEDGKFVGDSDVGEFWSLFGGYAPIPRDSPSAFQQQPDTPSTTFFWINLQGKLCQIAANSLNKDMLEKDKCYMLDCVNEVFVWTGRNTSITERRISISASEDFLRNQGRTTGTHLTFLTEGLETTVFRSYFDSWPQIAEPKLYDEGREKVAAIFKQQGHDVKELPEEDFEPYVNCRGILKVWRVNGDELSLLPAAEQMKLFSGDCYIVKYTYPGNGRDENVIYAWFGHESMTEDRAAAISHMSAIVDSTRGEAVMAQVHQDMEPVQFFLIFQSLIVFKGGLSTQYKKFIVEEGIVDETYDEKKMALFCIQGTSPCNMQAFQVDRVSTCLNSSYCYILQNGASVFTWIGNLSSSRDHDLLDRMVELINPTWQPISVREGSEPEVFWNALGGKSEYPREKEIKGFIEDPHLFTCTLTEGDLKVKEIYNFTQDDLTTEDILVLDCCREIYVWIGCHSDLNSKQQALNIGQKFLETDILVEGLSLETPIYVVTEGHEPPFFTCFFAWDPLKAKMHGNSFERKLAILKGRPSI-EASVRNSWKPYFGETTPDSLRSRSVSSNGLQGSGSPIPSISSSKLNSADRHRAFCETPTAQLLFSESTLDKDSLTGEPSSSSKSTKAIQFNESEAGVSSLIYSYEQLRVDSRNPVIGIDVTKREV 865          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: VILI1_ARATH (Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 458/777 (58.94%), Postives = 577/777 (74.26%), Query Frame = 1
Query:    1 GDTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVT-LFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELP-EEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKGKTSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISS-PTPVARKLFTGSSPYQ-DSPVVEPSSPSTNENSHQ-----IDANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            G+TYQVTLL CKGDHV  VKEVPF RSSLNH+DVFILDTASK+FLF GCNSS QE+AKA+EVV+YIK+NKH G+CEVATIEDGK  GDSD GEFWS FGGYAPIP+ S+    +Q   P   LFWI  +G L   G+ SL+KDMLEKNKC+MLDC +EVFVWMGRNT +TERKTSIS++E+FLRK+ RS  T L  LTEGLE   F+S+FN WPQT E+ LY+EGREKVAA+FK +GY+V+ELP EED   Y NCR  LKVWRV+G ++SLL   +QTKL++GDCY+VQY Y   ER E L Y W+G  S+ +DRADA+ +  AIV + +G+ V+  I Q  EP +FF +FQ+L+V+KGG+S  YK  +AE     + Y+E K +LFR+ GT P NMQAIQV+ V++SLNSSY YILQ G S FTWIG L+S  DH++LDRM+  ++ + QPI +REG+E D+FW+ LGGK+EYP+EKEM+K IE+PHLF  +C+    KVKEIY+F QDDLTTEDV +LDC  E+YVWIG +S IKSK+EAL LGLKFL+ +ILEE L +  P+YVVTEGHEPPFFT FFEW P KANMHGNSFERKLA+LKGK ++    S +  + +S+D     L+SRS SSNG ER  SP S+     L  +++ + SS  TPV +KLF+ S     +  V    S S ++ S Q     I+++ +S  SL Y Y++L V S +PV+ ID T+REAYL+E+EF E+ GM K  FY LPKW+QNKLK+++ LF
Sbjct:  133 GETYQVTLLRCKGDHVVRVKEVPFLRSSLNHDDVFILDTASKVFLFAGCNSSTQEKAKAMEVVEYIKDNKHDGRCEVATIEDGKFSGDSDAGEFWSFFGGYAPIPKLSSSTTQEQTQTPCAELFWIDTKGNLHPTGTSSLDKDMLEKNKCYMLDCHSEVFVWMGRNTSLTERKTSISSSEEFLRKEGRSTTTSLVLLTEGLENARFRSFFNKWPQTVESSLYNEGREKVAALFKQKGYDVEELPDEEDDPLYTNCRDNLKVWRVDGDDVSLLSIPDQTKLFTGDCYLVQYKYTYKERTEHLLYVWIGCESIQQDRADAITNASAIVGTTKGESVLCHIYQGNEPSRFFPMFQSLVVFKGGLSRRYKVLLAEKEKIGEEYNENKASLFRVVGTSPRNMQAIQVNLVATSLNSSYSYILQYGASAFTWIGKLSSDSDHEVLDRMLYFLDTSCQPIYIREGNETDTFWNLLGGKSEYPKEKEMRKQIEEPHLFTCSCSSDVLKVKEIYNFVQDDLTTEDVFLLDCQSEVYVWIGSNSNIKSKEEALTLGLKFLEMDILEEGLTMRTPVYVVTEGHEPPFFTRFFEWVPEKANMHGNSFERKLASLKGKKTSTKRSSGSQYRSQSKDNASRDLQSRSVSSNGSERGVSPCSSEKLLSLSSAEDMTNSSNSTPVVKKLFSESLLVDPNDGVARQESSSKSDISKQKPRVGINSDLSSLESLAYSYEQLRVDSQKPVTDIDATRREAYLTEKEFEERFGMAKSEFYALPKWKQNKLKISLHLF 909          

HSP 2 Score: 76.2554 bits (186), Expect = 8.350e-13
Identity = 92/378 (24.34%), Postives = 173/378 (45.77%), Query Frame = 1
Query:  733 EDVQSYINCRGT---LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTY-PGTERDESLFYAWLGQGSVLEDRADAVFHMDAI--VDSARG-DPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREG-----SEPDSFWSSLGGKTEYPR--EKEMKKFIEDP--HLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EWDPSKANMHGNSFERKLATL 1800
            +D+ S     GT   L++W V   +L  +P S   K +SG+ Y+V  T+    E  +   + WLG   +  +  D++   D    +D+A G   V  +  Q +E  +F   F+  I+   G      K+  +TG+  +TY   +  L R +  G   ++  +V  + SSLN    +IL + + +F + G  +S+++      ++E I     +   +  ++ +G     S+   FWS  GG    P+      ++  + P   LF +  T+G+       S  +D L      +LDCH E++VW+GR++++  ++ +++   +FL+    +E       + ++TEG E   F  FF +W  +  +   N    K+A L
Sbjct:    6 KDIDSAFQGVGTKSGLEIWCVYNKQLISIPKSSFGKFHSGNAYLVLRTFLRKIESPQYDIHYWLG---IDANEVDSILASDKALDLDAALGCCTVQYREVQGQETEKFLSYFKPCIIPVEG------KYSPKTGIAGETY---QVTLLRCK--GDHVVRVKEVPFLRSSLNHDDVFILDTASKVFLFAGCNSSTQEKAKAMEVVEYIKDNKHDGRCEVATIEDGKFSGDSDAGEFWSFFGGYAPIPKLSSSTTQEQTQTPCAELF-WIDTKGNLHPTGTSSLDKDMLEKNKCYMLDCHSEVFVWMGRNTSLTERKTSISSSEEFLR----KEGRSTTTSLVLLTEGLENARFRSFFNKWPQTVESSLYNEGREKVAAL 364          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: VILI4_ARATH (Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 400/837 (47.79%), Postives = 528/837 (63.08%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKEL-----PEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EWDPSKANMHGNSFERKLATLK-GKTSTGTAPSRNALKPRS---RDATPDGLXXXXXXXX-----XXXXXXXPASTVSGSHLKFSDNYSISSPTPVARKLF---------------------TGSSPYQDSPVVEPS-------------SPSTNENSH------------------------QIDANETSANS---LIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            L  C+G HV HVKEVPF+RSSLNH+D++ILDT SKIF F G NSSIQERAKALEVVQYIK+  H G CEVAT+EDGKL+ D+D GEFW  FGG+AP+PR +A    +  +  +T  +   +G+ + +  D+L+++ML+ NKC++LDCG EVFVWMGR T + +RK +  AAE+ +R  ER   + +  + EG ET+ F+S F SW Q   T + ++GR +VAA+ + QG  V+ L     P+E+ Q +I+C G L+VWRVNG   +LL A++ +K YSGDCY+ QY+YPG E++E L   W G+ SV E+R  AV     +V+S +  P  A+I + KEP+QFF+I Q+ IV+KGGIS+GYKK+IAE  VDDDTY+E   ALFRIQG+GPENMQAIQVD V++SLNSSY YIL + +S+FTW GNL+++ D +L +R ++LI P  Q  + +EGSE + FW  LGGK EY  +K  K+   DPHLF  T T+   KV EIY+FTQDDL TED+ ++DCH EI+VW+G+    K+K  AL +G KF++ + L E+L  EAPIYV+ EG EP FFT FF  WD SK+ MHGNSF+RKL  +K G T     P R    P S   R + PD  + RS S +        R  SPA     +  +  +  ++S+P PV RKL+                     + S+ ++  P  EPS             SP+   NS                         Q DA E   +      +PY RL  +ST+PVS IDVT+REAYLS EEF EK GM K AFYKLPKW+QNK KMAV LF
Sbjct:  141 LFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFNGSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRKTANDEDKTYNSDITRLFCVEKGQANPVEGDTLKREMLDTNKCYILDCGIEVFVWMGRTTSLDDRKIASKAAEEMIRSSERPK-SQMIRIIEGFETVPFRSKFESWTQETNTTVSEDGRGRVAALLQRQGVNVRGLMKAAPPKEEPQVFIDCTGNLQVWRVNGQAKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVLIGTWFGKQSVEEERGSAVSMASKMVESMKFVPAQARIYEGKEPIQFFVIMQSFIVFKGGISSGYKKYIAEKEVDDDTYNENGVALFRIQGSGPENMQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATDQELAERQLDLIKPNQQSRAQKEGSESEQFWELLGGKAEYSSQKLTKEPERDPHLFSCTFTKEVLKVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVGQEVVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKSAMHGNSFQRKLKIVKNGGTPVADKPKRRT--PASYGGRASVPDKSQQRSRSMSFSPDRVRVRGRSPAFNALAATFESQNARNLSTPPPVVRKLYPRSVTPDSSKFAPAPKSSAIASRSALFEKIPPQEPSIPKPVKASPKTPESPAPESNSKEQEEKKENDKEEGSMSSRIESLTIQEDAKEGVEDEEDLPAHPYDRLKTTSTDPVSDIDVTRREAYLSSEEFKEKFGMTKEAFYKLPKWKQNKFKMAVQLF 974          

HSP 2 Score: 59.6918 bits (143), Expect = 1.160e-7
Identity = 78/347 (22.48%), Postives = 149/347 (42.94%), Query Frame = 1
Query:  760 RGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYP---GTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIV-YKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAW-----QPISVREG---SEPDSFWSSLGGKTEYPREK-----EMKKFIEDPHLFKFTCTE-GDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEP-PFFTCFFEW 1743
            +  +++WR+     + +P S   K ++GD YIV  T     G  R +   + WLG+ +  ++   A      +  +  G  V  +  Q  E  +F   F+  I+  +GG+++G+K  +AE         E  T LF  +G     +   +V    SSLN    YIL + + IF + G+ +S ++      +++ I   +     +  +V +G   ++ DS           P  +     E K +  D  + +  C E G     E  +  ++ L T    +LDC  E++VW+GR +++  ++ A     + ++++   +   +      + EG E  PF + F  W
Sbjct:   18 KAGIEIWRIENFIPTPIPKSSIGKFFTGDSYIVLKTTALKTGALRHD--IHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIPQEGGVASGFKHVVAE---------EHITRLFVCRGK--HVVHVKEVPFARSSLNHDDIYILDTKSKIFQFNGSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRKTANDEDKTYNSD--ITRLFCVEKGQANPVEGDTLKREMLDTNKCYILDCGIEVFVWMGRTTSLDDRKIASKAAEEMIRSSERPKSQMIR-----IIEGFETVPFRSKFESW 344          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: VILI5_ARATH (Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 377/842 (44.77%), Postives = 526/842 (62.47%), Query Frame = 1
Query:    4 DTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQ-QVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKEL-------PEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATL--KGK-------------TSTGTAPSRNALKPRSRDATPDGLXXXXXXXXXXXXXXXPASTVSGSHLKFSDNYSISSP----TPVARKLFTGS------------------------SPYQDSPVVEPSSPSTNENSHQIDA-------NETSANSLI-----------------YPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            + +Q  L  CKG HV  VKEVPF RS+LNH DVFILDT SKIF F G  SSIQERAKALEVVQYIK+  H GKC++A +EDG+++ D++ GEFW LFGG+AP+P+  A+   +      + LF +  +G+   + ++ L K++L+ NKC++LDCG E+FVW GR+T I +RK++  AAE+F R  E    ++L  + EG ET++F+S F+SWP ++      +GR KVAA+ + QG  V+ L        +++ + YI+  G L+VWR+N  E  LL A+EQ+K YSGDCYI+QY+YPG +R+E L   W G+ SV EDRA A+   + +V+S +  P  A+I + KEP+QFF+I Q+ I +KGG+S  +KK+IAE  + D TY+ +  ALFR+QG+GPENMQAIQ++  S+ LNSS+CYIL   +++FTW GNLTSS+D +L++RM++LI P     + +EGSE + FW  LGGK+EYP +K  +    DPHLF  T T    K  EI++FTQDDL TED+ +LDCH E++VW+G+    K K +AL++G  FL+ + L E L  E PIY+VTEG+EPPFFT FF WD SK+ MHG+SF+RKLA L  KGK             +S  T P ++  + RS   +PD             R  SPA     ++ +  +  + S+P    +P+ RKL+  S                        +P    P   P+SPS++E ++Q +A       NE  A S I                 +PY+RL   S +PVS +D+T+REAYL+  EF EK  M K  FYKLPKW+QNKLKM+V+LF
Sbjct:  135 EEHQTRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFSGSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKKPAVNDDETAASDGIKLFSVE-KGQTDAVEAECLTKELLDTNKCYILDCGLELFVWKGRSTSIDQRKSATEAAEEFFRSSEPPK-SNLVSVMEGYETVMFRSKFDSWPASSTIAEPQQGRGKVAALLQRQGVNVQGLVKTSSSSSKDEPKPYIDGTGNLQVWRINCEEKILLEAAEQSKFYSGDCYILQYSYPGEDREEHLVGTWFGKQSVEEDRASAISLANKMVESMKFVPAQARINEGKEPIQFFVIMQSFITFKGGVSDAFKKYIAENDIPDTTYEAEGVALFRVQGSGPENMQAIQIEAASAGLNSSHCYILHGDSTVFTWCGNLTSSEDQELMERMLDLIKPNEPTKAQKEGSESEQFWELLGGKSEYPSQKIKRDGESDPHLFSCTYTNESLKATEIFNFTQDDLMTEDIFILDCHTEVFVWVGQQVDPKKKPQALDIGENFLKHDFLLENLASETPIYIVTEGNEPPFFTRFFTWDSSKSGMHGDSFQRKLAILTNKGKPLLDKPKRRVPAYSSRSTVPDKSQPRSRSMTFSPD---------RARVRGRSPAFNALAANFEKLNIRNQSTPPPMVSPMVRKLYPKSHAPDLSKIAPKSAIAARTALFEKPTPTSQEP---PTSPSSSEATNQAEAPKSTSETNEEEAMSSINEDSKEEEAEEESSLPTFPYERLKTDSEDPVSDVDLTRREAYLTSVEFKEKFEMTKNEFYKLPKWKQNKLKMSVNLF 962          

HSP 2 Score: 78.5666 bits (192), Expect = 1.611e-13
Identity = 93/393 (23.66%), Postives = 171/393 (43.51%), Query Frame = 1
Query:  760 RGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESL---FYAWLGQGSVLEDRADAVFHMDAIVDSARGD-PVMAQIAQNKEPLQFFLIFQTLIV-YKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQP-----ISVREG-----SEPDSFWSSLGGKTEYPREKEMK--KFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAP---IYVVTEGHEPPFFTCFFEWDPSKANM----HGNS-----FERKLATLKGKTSTGTAPSRNALKP 1851
            +  +++WR+   +   +P     K ++GD YIV  T     R  SL    + WLG+ S  +D A AV  M   +DSA G   V  +  Q  E  +F   F+  I+  +GG+++G+     E         E +T L+  +G     ++  +V  V S+LN    +IL + + IF + G+ +S ++      +++ I   +        +V +G     +E   FW   GG    P++  +   +      +  F+  +G     E    T++ L T    +LDC  E++VW GR ++I  ++ A     +F +++        E P   +  V EG+E   F   F+  P+ + +     G        +R+   ++G   T ++ S++  KP
Sbjct:   18 KSGIEIWRIENFKPVTVPQESHGKFFTGDSYIVLKTT--ASRSGSLHHDIHYWLGKDSS-QDEAGAVAVMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIPQEGGVASGFNHVKPE---------EHQTRLYICKGK--HVVRVKEVPFVRSTLNHEDVFILDTESKIFQFSGSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKKPAVNDDETAASDGIKLFSVEKGQTDAVEAECLTKELLDTNKCYILDCGLELFVWKGRSTSIDQRKSATEAAEEFFRSS--------EPPKSNLVSVMEGYETVMFRSKFDSWPASSTIAEPQQGRGKVAALLQRQGVNVQGLVKTSSSSSKDEPKP 388          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: VILI3_ARATH (Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2)

HSP 1 Score: 519.235 bits (1336), Expect = 2.270e-167
Identity = 272/604 (45.03%), Postives = 385/604 (63.74%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGG---PQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPE-----EDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYA-WLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKG 1806
            L TCKG    H+K+VPF+RSSLNH+DVFILDT  KI+ F G NS+IQERAKAL V+QY+K+  H G  +VA ++DGKL  +SD GEFW LFGG+API R  A      P+    P  L+ I+  G++  I  D L K MLE NKC++LDCG+E+F+W+GR T + ERKT+I AAEDF+  + R   T +T + +G E   FKS F+SWP  + T   +EGR KVAA+ K QG  +K L +     ED+   +   G L+VW ++ +  ++L      KLYSGDCY+V YTY   ER E  F   W G+ S  ED+  AV     + +S +G PV A+I + KEP QF  +FQ ++V KGG+S+GYK  + E G   +TY  +  AL ++ GTG  N +A+QV+ V++SLNS  C++LQSGTS+F W+GN ++ +  +L  ++ E + P       +EG+E  SFW +LGGK  +  +K   + + DPHLF F+   G F+V+EI++F QDDL TE++ +LD H E++VW+G+    K KQ A  +G +++      E L  + P+Y +TEG+EP FFT +F WD +KA + GNS+++K A L G
Sbjct:  141 LYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFNGANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARKVASEDEIIPETT--PPKLYSIA-DGQVESIDGD-LSKSMLENNKCYLLDCGSEIFIWVGRVTQVEERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGKVAALLKQQGVGLKGLSKSTPVNEDIPPLLEGGGKLEVWYIDANSKTVLSKDHVGKLYSGDCYLVLYTYHSGERKEDYFLCCWFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVVLKGGLSSGYKNSMTEKGSSGETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSMFLWVGNHSTHEQQELAAKVAEFLKPGTTIKHAKEGTESSSFWFALGGKQNFTSKKVSSETVRDPHLFSFSFNRGKFQVEEIHNFDQDDLLTEEMHLLDTHAEVFVWVGQCVDPKEKQTAFEIGQRYINLAGSLEGLSPKVPLYKITEGNEPCFFTTYFSWDSTKATVQGNSYQKKAALLLG 740          

HSP 2 Score: 73.1738 bits (178), Expect = 7.085e-12
Identity = 34/71 (47.89%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2092 DANETSANSLIYPYQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            D +E     + + Y+RL   S +PV+GID  +REAYLSE EF    GM K +FYKLP W+Q+ LK   +LF
Sbjct:  895 DDSEVETTGVTFTYERLQAKSEKPVTGIDFKRREAYLSEVEFKTVFGMEKESFYKLPGWKQDLLKKKFNLF 965          

HSP 3 Score: 66.6254 bits (161), Expect = 7.524e-10
Identity = 91/374 (24.33%), Postives = 154/374 (41.18%), Query Frame = 1
Query:  772 KVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLF--YAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIV-YKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREG-------------SEPDS--FWSSLGGKTEYPR----EKEMKKFIEDPHLFKFTCTEGDFKVKEI-YSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFER-KLATLKGKTSTG 1821
            ++WR+   E   +P SE  K Y GD YIV  T    +    LF  + W+G+ +  ++   A      +  +  G  V  +  Q  E  +F   F+  I+  +GG+++G+KK            +E +T L+  +G    +++  QV    SSLN    +IL +   I+ + G      + ++ +R   L+   +      EG             +E DS  FW   GG     R    E E+      P L+       D +V+ I    ++  L      +LDC  EI++W+GR + ++ ++ A+     F    +  E       I  V +G+EP  F   F+  PS +    N   R K+A L  +   G
Sbjct:   22 EIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQ-NKGGAYLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIPLEGGVASGFKK---------PEEEEFETRLYTCKGKRAVHLK--QVPFARSSLNHDDVFILDTKEKIYQFNG-----ANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARKVASEDEIIPETTPPKLYSI----ADGQVESIDGDLSKSMLENNKCYLLDCGSEIFIWVGRVTQVEERKTAIQAAEDF----VASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGKVAALLKQQGVG 370          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: VILI2_ARATH (Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2)

HSP 1 Score: 519.235 bits (1336), Expect = 2.509e-167
Identity = 274/610 (44.92%), Postives = 385/610 (63.11%), Query Frame = 1
Query:    4 DTYQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGG---PQQVDRPVTLFWISLQGKLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPE-----EDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTER-DESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFERKLATLKG 1806
            + ++  L TCKG     +K+VPF+RSSLNH+DVFILDT  KI+ F G NS+IQERAKALEVVQY+K+  H G C+VA ++DGKL  +SD G FW LFGG+API R  A      P+    P  L+ I+  GK+  I  D L K MLE  KC++LDCGAE+++W+GR T + ERK +  +AE+FL  + R   TH+T + +G E+  FKS F+SWP  + T   +EGR KVAA+ K QG  +K + +     ED+   +   G L+VW VNG   + LP  +  KLYSGDCY+V YTY   ER DE     W G+ S+ ED+  A+   + + +S +G PV  +I + KEP QF  +FQ ++V KGG+S+GYK  + E+   D+TY  +  AL ++ GTG  N +A+QV+ V++SLNS  C++LQSGTS+F W GN ++ +  +L  ++ E + P       +EG+E  +FW +LGGK  +  +K   + I DPHLF F    G F+V+EIY+F QDDL TED+  LD H E++VW+G+    K KQ    +G K++      E L  + PIY + EG+EP FFT +F WD +KA + GNSF++K + L G
Sbjct:  133 EVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNGANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKVANDDDIVPEST--PPKLYCIT-DGKMEPIDGD-LSKSMLENTKCYLLDCGAEIYIWVGRVTQVDERKAASQSAEEFLASENRPKATHVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGKVAALLKQQGVGLKGIAKSAPVNEDIPPLLESGGKLEVWYVNGKVKTPLPKEDIGKLYSGDCYLVLYTYHSGERKDEYFLSCWFGKKSIPEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVVLKGGLSSGYKSSMGESESTDETYTPESIALVQVSGTGVHNNKAVQVETVATSLNSYECFLLQSGTSMFLWHGNQSTHEQLELATKVAEFLKPGITLKHAKEGTESSTFWFALGGKQNFTSKKASSETIRDPHLFSFAFNRGKFQVEEIYNFAQDDLLTEDIYFLDTHAEVFVWVGQCVEPKEKQTVFEIGQKYIDLAGSLEGLHPKVPIYKINEGNEPCFFTTYFSWDATKAIVQGNSFQKKASLLFG 738          

HSP 2 Score: 69.3218 bits (168), Expect = 1.168e-10
Identity = 48/144 (33.33%), Postives = 67/144 (46.53%), Query Frame = 1
Query: 1948 SHLKFSDNYSISSPTPVARKLFTGSSPYQDSPVVEPS-------------------SPSTNENSHQIDANETSANSLIYP------YQRLTVSSTEPVSGIDVTKREAYLSEEEFAEKIGMPKGAFYKLPKWRQNKLKMAVDLF 2304
            S +  ++N      +P  R   T S+P  D P+ E                     SP+ +E   + +  E   +S I P      Y++L   S  PV+GID  +REAYLSEEEF    G+ K AF  LP+W+Q+ LK   DLF
Sbjct:  836 SQVLVAENKKSPDTSPTRRS--TSSNPADDIPLTEAKDEEEASEVAGLEAKEEEEVSPAADETEAKQETEE-QGDSEIQPSGATFTYEQLRAKSENPVTGIDFKRREAYLSEEEFQSVFGIEKEAFNNLPRWKQDLLKKKFDLF 976          

HSP 3 Score: 64.6994 bits (156), Expect = 3.533e-9
Identity = 89/372 (23.92%), Postives = 160/372 (43.01%), Query Frame = 1
Query:  772 KVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLF--YAWLGQGSVLEDRADAV---FHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIV-YKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPIS-----VREG-----SEPDSFWSSLGGKTEYPREKEMKKFI----EDPHLFKFTCTEGDFKVKEI-YSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFEWDPSKANMHGNSFER-KLATLKGKTSTG 1821
            ++WR+   E   +P SE  K Y GD YIV  T    +    LF  + W+G+ +  ++   A      +DA++    G  V  +  Q  E  +F   F+  I+  +GG+++G+K       V+++ ++   T L+  +G     ++  QV    SSLN    +IL +   I+ + G  ++ ++      +++ +   +   +     V +G     S+  +FW   GG     R+      I      P L+  T    D K++ I    ++  L      +LDC  EIY+W+GR + +  ++ A     +FL +    E       +  V +G+E   F   F+  PS +   GN   R K+A L  +   G
Sbjct:   20 EIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQ-NKGGAYLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLG---GRAVQHREIQGHESDKFLSYFKPCIIPLEGGVASGFKT------VEEEVFE---TRLYTCKGK--RAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNGANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKVANDDDIVPESTPPKLYCIT----DGKMEPIDGDLSKSMLENTKCYLLDCGAEIYIWVGRVTQVDERKAASQSAEEFLAS----ENRPKATHVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGKVAALLKQQGVG 368          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: GELS_HOMAM (Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 4.880e-68
Identity = 175/612 (28.59%), Postives = 296/612 (48.37%), Query Frame = 1
Query:   10 YQVTLLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQVD---------RPVTLFWISLQG----KLSQIGSDSLEKDMLEKNKCFMLDCGAEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAET----KLYDEGREKVAAIFKHQGYEVKELPEEDVQ--------SYINCRGTLKVWRVNG--HELSLLPASEQTK--LYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQ-TLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCT-EGDFKVKEIYSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EWDP 1749
            Y   L   KG     +++V     S+N  D FILD  S+++ + G +S   +R KA++    ++ + H+GK +V  I++      S+ GE     GG +P   D        VD           VTL  I   G    + + IG   L + ML+   CF+LD G  V+VW+G  +   E+  S+  A  ++ K+     T++  + E  E  +FK+YF +W +  E     +++ + R+  A       ++V  L  E  +        ++  C   +   R  G    L L P  E T    + GD Y+++Y Y     +  + Y W G  S  +++A +  H   + +   G  V  ++ Q  EP  F  IF+  ++++ GG ++G+K        D DTYD   T LFR++GT   + +AIQ   V+ SLNS   ++L++    + WIG   S ++  + ++++EL++P    ++V EG E D FW  LGGK +Y   +++ + +  P LF  T +  G  +V E+  F Q+DL  +DV+VLD   E+YVW+G+ S  + K++A  +   +++T+  E  L     I  + +G EP  FT  F  W+P
Sbjct:  130 YPARLFHVKGRRNIRIRQVEVGVGSMNKGDCFILDCGSQVYAYMGPSSRKMDRLKAIQAANPVRADDHAGKAKVIVIDE--TASGSEAGESSPGLGGGSP---DDVADEDTGVDDSAFERSEVNVVTLHHIFEDGDGVIQTNMIGEKPLLQSMLDSGDCFLLDTGVGVYVWIGSGSSKKEKVKSMELAAGYMEKKGYPTYTNVQRVVEKAEPAVFKAYFKTWREPQEQIGLGRVFTQ-RQMSAVSATETDFDVSSLHAEKRRLLQKNAGPAFALCPIMVLARRNLGPLRTLKLEPVDESTHGFFFGGDSYVLKYIYEVNGNERYILYFWQGCASSQDEKASSAIHTVRLDNELCGKAVQVRVVQGYEPAHFLRIFKGRMVIFLGGKASGFKNVH-----DHDTYDVDGTRLFRVRGTCDFDTRAIQQTEVAGSLNSDDVFVLETPGKTYLWIGKGASEEEKAMGEKVVELVSPGRDMVTVAEGEEDDDFWGGLGGKGDYQTARDLDRPLLYPRLFHCTISPAGCLRVNEMSDFAQEDLNEDDVMVLDSGDEVYVWVGQGSDDQEKEKAFTMAENYIKTDPTERTLDATV-ILRINQGEEPAAFTSIFPAWNP 729          

HSP 2 Score: 70.0922 bits (170), Expect = 6.877e-11
Identity = 96/405 (23.70%), Postives = 162/405 (40.00%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVY-KGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPA--------WQPISVRE---------------GSEPDSFWSSLGGKTEYPREKEMKKFIEDPHLFKFTCTEGDFKVKEIY----SFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYV----VTEGHEPPFFTCFFE-W-DPSKANMHGNSF-ERKLATLKGKTSTGTAPSRNALKPR--SRDATP 1872
            L +WR+   E+   P  +  + Y GD YIV YT           + WLG  +  ++   A      + D   G PV  +  +  E   F   F+  + Y KGG+++G+        VD D        LF ++G    N++  QV+    S+N   C+IL  G+ ++ ++G   SS+  D L + I+  NP          + I + E               G  PD       G  +   E+     +   H+F+    +GD  ++          Q  L + D  +LD    +YVWIG  S+ K K +++ L   +++            P Y     V E  EP  F  +F+ W +P +    G  F +R+++ +    +     S +A K R   ++A P
Sbjct:   14 LTIWRIENFEVVPYPKEKYGQFYQGDSYIVLYTRDVNGNLSWDLHFWLGSETSQDEAGTAAIKTVELDDQLGGVPVQHREVEGHETSLFLSRFKKGVRYLKGGVASGFHH------VDPDA--PYPARLFHVKGR--RNIRIRQVEVGVGSMNKGDCFILDCGSQVYAYMG--PSSRKMDRL-KAIQAANPVRADDHAGKAKVIVIDETASGSEAGESSPGLGGGSPDDVADEDTGVDDSAFERSEVNVVTLHHIFE----DGDGVIQTNMIGEKPLLQSMLDSGDCFLLDTGVGVYVWIGSGSSKKEKVKSMELAAGYMEKKGY--------PTYTNVQRVVEKAEPAVFKAYFKTWREPQEQIGLGRVFTQRQMSAVSATETDFDVSSLHAEKRRLLQKNAGP 393          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: GELS_HORSE (Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 8.340e-65
Identity = 176/620 (28.39%), Postives = 296/620 (47.74%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQV-DRPVTLFWISLQGKLSQIGS-----DSLEKDMLEKNKCFMLDCG--AEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGREKVAAIFKHQGYEVKELPEEDVQSYINCR------------GTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIF--QTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEY---PREKEMKKFIEDPHLFKFTCTEGDFKVKEIYS-FTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPP-FFTCFFEWDPSKANMHGNSFERKLATL 1800
            LL  KG  V    EVP S  S N+ D FILD  + I+ +CG  S+  ER KA +V + I++N+ SG+ +V+  E+G     ++      + G    +P  +     +   +R +   +    G    + S     +   +  L    CF+LD G   ++FVW G+   + ERK ++  A DF+ K +    T ++ L EG ET +F+ +F +W    +T    EG   +A +  H  + V+ +P +    + +              G  ++WRV G     +  +   + Y GD YI+ Y Y    R   + Y W G  S  ++ A +      + +   G PV +++ Q KEP     +F  + +IVYKGG S            +        T LF+++ +     +A+++   + +LNS+  ++L++ ++ + W+G   S  +      ++ ++    QP+ V EGSEPDSFW +LGGK  Y   PR K+ K     P LF  +   G F ++E+   F Q+DL T+DV++LD   +++VW+G+ S  + K EAL    +++ T+    +     PI VV +G EPP F   F  WD S  ++  +  +R LA L
Sbjct:  138 LLQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIYQWCGSKSNRFERLKATQVSKGIRDNERSGRAQVSVFEEG-----AEPEAMLQVLGPKPTLPEATEDTVKEDAANRKLAKLYKVSNGAGPMVVSLVADENPFAQGALRSEDCFILDHGKDGKIFVWKGKQANMEERKAALKTASDFISKMDYPKQTQVSVLPEGGETPLFRQFFKNWRDPDQT----EGL-GLAYLSSHIAH-VERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRVEGSNKVPVDPATYGQFYGGDSYIILYNYRHGSRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIVYKGGTSR-----------EGGQTAPASTRLFQVRASSSGATRAVEIIPKAGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLRVLRA--QPVQVAEGSEPDSFWEALGGKATYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGEFMQEDLATDDVMLLDTWDQVFVWVGKDSQDEEKTEALTSAKRYIDTDPAHRD--RRTPITVVKQGFEPPSFVGWFLGWDDSYWSV--DPLDRALAEL 729          

HSP 2 Score: 68.9366 bits (167), Expect = 1.459e-10
Identity = 90/359 (25.07%), Postives = 153/359 (42.62%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYA---WLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYK-GGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI----NPAWQPISV-REGSEPDSFWSSLGGKTEYPREKEMKKFIED------PHLFKFTCTEGDFKVKEIYS---FTQXXXXXXXXXXXXCHKE--IYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFE-W-DPSKANMHGNSF 1779
            L++WRV   +L  +P +     ++GD Y++  T     R+  L Y    WLG     ++   A      + D   G  V  +  Q  E   F   F++ + YK GG+++G+K  +    V              +Q  G   ++A +V     S N+  C+IL  G +I+ W G+ ++  +     ++ + I          +SV  EG+EP++    LG K   P   E     ED        L+K +   G   V  +     F Q  L +ED  +LD  K+  I+VW G+ + ++ ++ AL     F    I + +   +  + V+ EG E P F  FF+ W DP +    G ++
Sbjct:   17 LQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTV--QLRNGILQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL----------LQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIYQWCGSKSNRFERLKATQVSKGIRDNERSGRAQVSVFEEGAEPEAMLQVLGPKPTLPEATE-DTVKEDAANRKLAKLYKVSNGAGPMVVSLVADENPFAQGALRSEDCFILDHGKDGKIFVWKGKQANMEERKAALKTASDF----ISKMDYPKQTQVSVLPEGGETPLFRQFFKNWRDPDQTEGLGLAY 358          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: GELS_RAT (Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.583e-64
Identity = 175/619 (28.27%), Postives = 291/619 (47.01%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQV--DRPVTLFWISLQGKLSQIG----SDSLEKDMLEKNKCFMLDCG--AEVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSW--------PQTAETKLYDEGREKV---AAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIF--QTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEY---PREKEMKKFIEDPHLFKFTCTEGDFKVKEIYS-FTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPP-FFTCFFEWDPSKANMHGNSFERKLATL 1800
            L   KG  V    EVP S  S N+ D FILD  + I+ +CG  S+  ER KA +V + I++N+ SG+ +V   E+G     S+      + G    +P+ +     +     R   L+ +S  G    +      +   +  L    CF+LD G   ++FVW G+   + ERK ++  A DF+ K +    T ++ L EG ET +FK +F +W        P  +    +    E+V   AA          +   +D     +  G  ++WR+ G    L+  +   + Y GD YI+ Y Y    R   + Y W G  S  ++ A +      + +   G PV +++ Q KEP     +F  + +I+YKGG S            D        T LF+++ +     +A++V   + +LNS+  ++L++ ++ + W+G   S  +      +++++    Q + V EGSEPD FW +LGGKT Y   PR K+ K     P LF  +   G F ++E+     Q+DL T+DV++LD   +++VW+G+ S  + K EAL    ++++T+    +     PI VV +G EPP F   F  WD    ++  +  +R LA L
Sbjct:  187 LFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEG-----SEPEAMLQVLGPKPDLPQGTEDTAKEDAANRRLAKLYKVSNSGGSMSVSLVADENPFAQSALRSEDCFILDHGRDGKIFVWKGKQANMDERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDD-----DGTGQKQIWRIEGSNKVLVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSR-----------DGGQTTPASTRLFQVRASSSGATRAVEVMPKAGALNSNDAFVLKTPSAAYLWVGTGASDAEKTGALELLKVLRA--QHVQVEEGSEPDGFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRD--RRTPITVVRQGFEPPSFVGWFLGWDDDYWSV--DPLDRALAEL 778          

HSP 2 Score: 74.7146 bits (182), Expect = 2.466e-12
Identity = 94/360 (26.11%), Postives = 158/360 (43.89%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYA---WLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYK-GGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMI-------ELINPAWQPISVREGSEPDSFWSSLGGKTEYPR-----EKEMKKFIEDPHLFKFTCTEGDFKVKEIYS---FTQXXXXXXXXXXXXCHKE--IYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFE-W-DPSKANMHGNSF 1779
            L++WRV   +L  +P +     ++GD Y++  T     R+ +L Y    WLG     ++   A      + D   G  V  +  Q  E   F   F++ + YK GG+++G+K  +    V           LF+++G     ++A +V     S N+  C+IL  G +I+ W G+  S+K   L    +       E    A   +S  EGSEP++    LG K + P+      KE         L+K + + G   V  +     F Q  L +ED  +LD  ++  I+VW G+ + +  ++ AL     F    I + +   +  + V+ EG E P F  FF+ W DP + +  G S+
Sbjct:   66 LQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTV--QLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFQGYFKSGLKYKKGGVASGFKHVVPNEVV--------VQRLFQVKGR--RVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGS-GSNKFERLKATQVSKGIRDNERSGRAQVHVS-EEGSEPEAMLQVLGPKPDLPQGTEDTAKEDAANRRLAKLYKVSNSGGSMSVSLVADENPFAQSALRSEDCFILDHGRDGKIFVWKGKQANMDERKAALKTASDF----ISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSY 407          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: GELS_CHICK (Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 9.357e-64
Identity = 173/602 (28.74%), Postives = 290/602 (48.17%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIPRDSALGGPQQ-VDRPVTLFWISLQGKLSQIGS-----DSLEKDMLEKNKCFMLDCGAE--VFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAETKLYDEGR--------EKV----AAIFKHQGYEVKELPEEDVQSYINCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIF--QTLIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEY---PREKEMKKFIEDPHLFKFTCTEGDFKVKEI-YSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EWD 1746
            LL  KG       EVP S  S N  D FILD  S I+ +CG NS+ QER KA  + + I++N+ +G+ +V   E+G     ++  E   + G    +P+ ++        +R +   +    G  +   S     +   +  L    CF+LD G +  +FVW GR+    ERK ++  A DF+ K      T +  L E  ET +FK +F +W    +T+   E          EKV    A +   +    +   E+D        G  ++WR+ G E   +  +   + Y GD YI+ Y Y    +   + Y W G  S  ++ A + F    + +   G PV  ++ Q KEP     +F  + LIVYKGG S            +       +T LF+++ +     +A+++D  +S LNS+  ++L++ ++ + W+G  ++S +      +++++    +P+ V EG EPD+FW +LGGK  Y   PR K+ K     P LF  +   G F ++E+    TQDDL T+DV++LD   +++VWIG+ +  + K EAL    ++++T+    +     P+ +V +G EPP F+ +F  WD
Sbjct:  185 LLQVKGRRTVRATEVPVSWESFNTGDCFILDLGSNIYQWCGSNSNRQERLKATVLAKGIRDNEKNGRAKVFVSEEG-----AEREEMLQVLGPKPSLPQGASDDTKTDTANRKLAKLYKVSNGAGNMAVSLVADENPFSQAALNTEDCFILDHGTDGKIFVWKGRSANSDERKAALKTATDFIDKMGYPKHTQVQVLPESGETPLFKQFFKNWRDKDQTEGLGEAYISGHVAKIEKVPFDAATLHTSRAMAAQHGMEDD------GSGKKQIWRIEGSEKVPVDPATYGQFYGGDSYIILYDYRHAGKQGQIIYTWQGAHSTQDEIATSAFLTVQLDEELGGSPVQKRVVQGKEPPHLMSMFGGKPLIVYKGGTSR-----------EGGQTTPAQTRLFQVRSSTSGATRAVELDPAASQLNSNDAFVLKTPSAAYLWVGRGSNSAELSGAQELLKVLGA--RPVQVSEGREPDNFWVALGGKAPYRTSPRLKDKKMDAYPPRLFACSNKSGRFTIEEVPGDLTQDDLATDDVMILDTWDQVFVWIGKDAQEEEKTEALKSAKRYIETDPASRD--KRTPVTLVKQGLEPPTFSGWFLGWD 760          

HSP 2 Score: 71.2478 bits (173), Expect = 3.054e-11
Identity = 82/346 (23.70%), Postives = 146/346 (42.20%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYA---WLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYK-GGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIELI-----NPAWQPISVREGSEPDSFWSSLGGKTEYPR--------EKEMKKFIEDPHLFKFTCTEGDFKVKEIYS---FTQXXXXXXX--XXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFFE 1740
            L++WR+   +L  +P +     ++GD Y+V  T    +R  +L Y    WLG  S  ++R  A      + D  +G  V  +  Q  E   F   F++ I YK GG+++G++  +            + T    +Q  G   ++A +V     S N+  C+IL  G++I+ W G+ ++ ++      + + I     N   +     EG+E +     LG K   P+        +   +K  +   L+K +   G+  V  +     F+Q  L TED  +L      +I+VW GR +    ++ AL     F+      +       + V+ E  E P F  FF+
Sbjct:   64 LQIWRIEKFDLVPVPKNLYGDFFTGDSYLVLNTI--RQRSGNLQYDLHFWLGDESSQDERGAAAIFTVQMDDYLQGKAVQHREVQGHESSTFLGYFKSGIKYKAGGVASGFRHVVPN----------EVTVQRLLQVKGRRTVRATEVPVSWESFNTGDCFILDLGSNIYQWCGSNSNRQERLKATVLAKGIRDNEKNGRAKVFVSEEGAEREEMLQVLGPKPSLPQGASDDTKTDTANRKLAK---LYKVSNGAGNMAVSLVADENPFSQAALNTEDCFILDHGTDGKIFVWKGRSANSDERKAALKTATDFIDKMGYPK----HTQVQVLPESGETPLFKQFFK 390          
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Match: ADSV_MOUSE (Adseverin OS=Mus musculus GN=Scin PE=1 SV=3)

HSP 1 Score: 233.032 bits (593), Expect = 1.030e-63
Identity = 179/603 (29.68%), Postives = 303/603 (50.25%), Query Frame = 1
Query:   22 LLTCKGDHVAHVKEVPFSRSSLNHNDVFILDTASKIFLFCGCNSSIQERAKALEVVQYIKENKHSGKCEVATIEDGKLVGDSDVGEFWSLFGGYAPIP---RDSALGGPQQVDRPVTLFWISLQG---KLSQIGSDS-LEKDMLEKNKCFMLDCGA--EVFVWMGRNTLITERKTSISAAEDFLRKQERSNGTHLTFLTEGLETLIFKSYFNSWPQTAET----KLYDEGREKVAAIFKHQGYEVKEL---PEEDVQSYI--NCRGTLKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQT--LIVYKGGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQ-SGTSIFTWIGNLTSSKDHDLLDRMIELINPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIED--PHLFKFTCTEGDFKVKEI-YSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EWDPSK 1755
            LL  KG  V    EVP S  S N  D FI+D  ++I+ +CG + +  ER KA +V   I++N+  G+ ++  +E+G     S+  E   + G    +P    D  +       +   L+ +S      K++ +  ++     ML   +CF+LD GA  ++FVW G+N    ERKT++  AE+FL+K + S  T +  L EG ET IFK +F  W    ++    K+Y    EKVA I K   ++  +L   P+   Q  +  +  G +++WRV       +  S   + Y GDCYI+ YTYP  +    + Y W G  +  ++   + F    +  S  G  V  +++Q KEP     +F+   LI+YK G S    +  A             T LF+++       + ++VD  ++SLNS+  ++L+    + F WIG   S ++    + + +++    +   ++EG EP+ FW+SLGG+ +Y     ++   ED  P L+  +   G F ++E+   FTQDDL  +DV++LD  ++I++WIG+ +    K+E++     +L+T+    +     PI ++ +GHEPP FT +F  WD S+
Sbjct:  139 LLHVKGRRVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGSSCNKYERLKASQVAIGIRDNERKGRSQLIVVEEG-----SEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSDASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQKMKYSTNTQIQVLPEGGETPIFKQFFKDWKDKDQSDGFGKVYIT--EKVAQI-KQIPFDASKLHSSPQMAAQHNMVDDGSGGVEIWRVENSGRVQIDPSSYGEFYGGDCYIILYTYPRGQ----IIYTWQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLIIYKNGTSKKEGQAPAPP-----------TRLFQVRRNLASITRIVEVDVDANSLNSNDTFVLKLPRNNGFIWIGKGASQEEEKGAEYVADVLKC--KASRIQEGKEPEEFWNSLGGRGDYQTSPLLETRAEDHPPRLYGCSNKTGRFIIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESVKSAKMYLETDPSGRD--KRTPIVIIKQGHEPPTFTGWFLGWDSSR 714          

HSP 2 Score: 88.5817 bits (218), Expect = 1.141e-16
Identity = 92/366 (25.14%), Postives = 149/366 (40.71%), Query Frame = 1
Query:  769 LKVWRVNGHELSLLPASEQTKLYSGDCYIVQYTYPGTERDESLFYAWLGQGSVLEDRADAVFHMDAIVDSARGDPVMAQIAQNKEPLQFFLIFQTLIVYK-GGISAGYKKFIAETGVDDDTYDEKKTALFRIQGTGPENMQAIQVDHVSSSLNSSYCYILQSGTSIFTWIGNLTSSKDHDLLDRMIEL------INPAWQPISVREGSEPDSFWSSLGGKTEYPREKEMKKFIED------PHLFKFTCTEGDFKVKEI-----YSFTQXXXXXXXXXXXXCHKEIYVWIGRHSTIKSKQEALNLGLKFLQTNILEEELFLEAPIYVVTEGHEPPFFTCFF-EW-DPSKANMHGNSF-ERKLATLK 1803
            L+VWRV   EL  +P       Y GD Y+V +T   +       + WLG+    ++   A      + D   G PV ++  Q  E   F   F+  + YK GG+++G    +        T D     L  ++G     ++A +V     S N   C+I+  GT I+ W G+ + +K   L    + +           Q I V EGSEP      LG K E P        + D        L+  +   G  KV  +     +S          +L     K+I+VW G+++  + ++ A+    +FLQ    + +      I V+ EG E P F  FF +W D  +++  G  +   K+A +K
Sbjct:   19 LQVWRVEKLELVPVPQGAYGDFYVGDAYLVLHTTKSSRGFSYRLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKGGLKYKAGGVASGLNHVL--------TNDLTAKRLLHVKGR--RVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGS-SCNKYERLKASQVAIGIRDNERKGRSQLIVVEEGSEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSDASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQ----KMKYSTNTQIQVLPEGGETPIFKQFFKDWKDKDQSDGFGKVYITEKVAQIK 369          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0D2TGG1_GOSRA5.013e-898.18Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061GZW4_THECC2.269e-788.41Villin-like 1 OS=Theobroma cacao GN=TCM_041634 PE=... [more]
A0A0D2RX03_GOSRA7.432e-898.19Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A0D2UIS3_GOSRA7.185e-898.03Uncharacterized protein OS=Gossypium raimondii GN=... [more]
V4RUE1_9ROSI0.000e+071.00Uncharacterized protein OS=Citrus clementina GN=CI... [more]
D7SJY9_VITVI7.436e-969.45Putative uncharacterized protein OS=Vitis vinifera... [more]
B9HP49_POPTR0.000e+068.73Uncharacterized protein OS=Populus trichocarpa GN=... [more]
M5W752_PRUPE1.448e-1068.65Uncharacterized protein OS=Prunus persica GN=PRUPE... [more]
B9SI12_RICCO1.665e-969.08Villin 1-4, putative OS=Ricinus communis GN=RCOM_0... [more]
A0A067FUI7_CITSI0.000e+070.94Uncharacterized protein OS=Citrus sinensis GN=CISI... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0001616 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
VILI1_ARATH8.350e-1358.94Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2[more]
VILI4_ARATH1.160e-747.79Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1[more]
VILI5_ARATH1.611e-1344.77Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1[more]
VILI3_ARATH2.270e-16745.03Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2[more]
VILI2_ARATH2.509e-16744.92Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2[more]
GELS_HOMAM4.880e-6828.59Gelsolin, cytoplasmic OS=Homarus americanus PE=1 S... [more]
GELS_HORSE8.340e-6528.39Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2[more]
GELS_RAT4.583e-6428.27Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1[more]
GELS_CHICK9.357e-6428.74Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1[more]
ADSV_MOUSE1.030e-6329.68Adseverin OS=Mus musculus GN=Scin PE=1 SV=3[more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 500..522
score: 52.96
coord: 388..408
score: 40.91
coord: 184..205
score: 40.7
coord: 529..548
score: 24.77
coord: 267..283
score: 50.27
coord: 325..345
score: 33.55
coord: 292..310
score: 27.03
coord: 448..467
score: 56.59
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 375..462
e-value: 3.9E-15
score: 66.3
coord: 1..94
e-value: 1.3E-22
score: 91.1
coord: 478..575
e-value: 8.8E-19
score: 78.4
coord: 113..205
e-value: 7.8E-14
score: 62.0
coord: 248..345
e-value: 3.1E-17
score: 73.2
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 697..760
coord: 1..605
IPR003128Villin headpieceSMARTSM00153VHP_1coord: 726..761
e-value: 3.8E-14
score: 63.0
IPR003128Villin headpieceGENE3D1.10.950.10coord: 691..761
e-value: 1.9E-20
score: 72.3
IPR003128Villin headpiecePFAMPF02209VHPcoord: 726..761
e-value: 1.6E-14
score: 53.5
IPR003128Villin headpiecePROSITEPS51089HPcoord: 696..761
score: 19.274
IPR003128Villin headpieceSUPERFAMILY47050VHP, Villin headpiece domaincoord: 698..761
IPR029006ADF-H/Gelsolin-like domainGENE3D3.40.20.10coord: 111..211
e-value: 4.8E-18
score: 64.6
IPR029006ADF-H/Gelsolin-like domainGENE3D3.40.20.10coord: 1..96
e-value: 7.4E-21
score: 73.6
coord: 477..589
e-value: 4.8E-21
score: 74.2
coord: 367..472
e-value: 3.9E-15
score: 55.1
IPR029006ADF-H/Gelsolin-like domainGENE3D3.40.20.10coord: 245..353
e-value: 2.4E-21
score: 75.0
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 494..568
e-value: 2.9E-11
score: 43.0
coord: 132..181
e-value: 9.9E-6
score: 25.2
coord: 392..456
e-value: 1.5E-5
score: 24.7
coord: 12..77
e-value: 5.6E-11
score: 42.0
IPR030010Villin-1, plantPANTHERPTHR11977:SF25VILLIN-1coord: 1..605
IPR030010Villin-1, plantPANTHERPTHR11977:SF25VILLIN-1coord: 697..760
NoneNo IPR availableSUPERFAMILY55753Actin depolymerizing proteinscoord: 85..215
NoneNo IPR availableSUPERFAMILY55753Actin depolymerizing proteinscoord: 365..468
NoneNo IPR availableSUPERFAMILY55753Actin depolymerizing proteinscoord: 238..384
NoneNo IPR availableSUPERFAMILY55753Actin depolymerizing proteinscoord: 451..573
NoneNo IPR availableSUPERFAMILY55753Actin depolymerizing proteinscoord: 2..101

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0001616 ID=g.arboreum_cottongen_reftransV1_0001616|Name=g.arboreum_cottongen_reftransV1_0001616|organism=Gossypium arboreum|type=contig|length=2623bp
GGGGACACATACCAAGTCACCTTGTTAACATGCAAGGGAGATCATGTCGC
TCATGTTAAAGAAGTTCCTTTTTCTCGATCATCCTTGAATCACAATGACG
TATTCATTCTTGACACTGCATCAAAAATTTTCCTCTTTTGTGGTTGCAAC
TCTAGCATCCAAGAAAGGGCTAAAGCTTTGGAGGTTGTTCAGTATATCAA
GGAGAATAAGCACTCTGGAAAATGTGAAGTGGCAACTATAGAGGATGGAA
AATTGGTTGGTGATTCTGATGTTGGTGAGTTCTGGAGTTTATTTGGTGGC
TATGCACCGATTCCCCGGGACTCAGCTTTGGGTGGTCCGCAACAAGTTGA
TCGTCCTGTAACATTATTTTGGATAAGTCTTCAGGGGAAACTATCTCAAA
TCGGAAGTGATTCACTGGAAAAAGATATGCTTGAGAAAAACAAGTGCTTT
ATGCTAGATTGTGGCGCTGAAGTTTTTGTCTGGATGGGAAGAAACACCTT
AATAACGGAACGAAAGACATCAATTTCAGCTGCAGAGGATTTCCTCAGAA
AACAAGAAAGGTCAAATGGGACTCACTTAACATTTTTAACTGAGGGATTA
GAAACTTTGATTTTTAAATCCTACTTTAATAGTTGGCCACAAACTGCCGA
GACCAAGCTGTATGATGAAGGGCGAGAAAAAGTGGCAGCAATATTCAAGC
ACCAGGGTTATGAAGTGAAGGAGCTTCCTGAAGAAGACGTCCAGTCTTAT
ATAAATTGCAGAGGCACCCTGAAGGTTTGGAGGGTAAATGGTCACGAACT
GTCTCTACTTCCAGCTTCAGAACAGACAAAGCTCTACAGTGGGGATTGCT
ATATTGTGCAGTATACATATCCTGGAACTGAAAGGGATGAGAGTTTATTT
TATGCATGGCTTGGTCAGGGCAGTGTACTGGAAGACAGAGCTGATGCTGT
CTTCCATATGGATGCTATTGTTGATTCAGCCAGAGGGGATCCAGTAATGG
CCCAGATTGCTCAAAATAAGGAGCCACTTCAGTTTTTCCTTATTTTCCAG
ACATTAATTGTTTATAAGGGAGGTATTAGTGCTGGATACAAAAAATTTAT
TGCTGAAACCGGTGTTGATGATGATACTTATGATGAGAAAAAGACTGCTC
TTTTTCGCATCCAAGGAACAGGTCCAGAAAACATGCAAGCTATCCAGGTT
GATCATGTTTCAAGCTCCCTGAATTCATCCTACTGTTACATCCTGCAAAG
TGGAACATCTATCTTCACTTGGATTGGGAATCTCACCTCAAGCAAAGACC
ACGATCTTCTTGATAGAATGATTGAGCTGATTAATCCAGCATGGCAACCC
ATATCAGTGAGGGAAGGAAGCGAACCAGATAGTTTCTGGAGTTCACTTGG
TGGAAAGACGGAGTATCCAAGAGAAAAGGAGATGAAGAAATTTATAGAAG
ATCCACATTTGTTCAAATTTACCTGTACTGAAGGTGATTTCAAGGTTAAA
GAGATATATAGCTTCACTCAAGATGATTTAACAACTGAAGATGTATTAGT
GCTAGATTGCCATAAAGAAATATATGTTTGGATTGGACGCCACTCGACTA
TTAAATCAAAGCAAGAAGCCCTTAACTTGGGTCTGAAATTCCTTCAAACA
AACATTCTGGAAGAAGAACTTTTTTTGGAGGCTCCTATATATGTTGTTAC
AGAAGGGCATGAACCACCATTCTTCACATGTTTTTTTGAATGGGATCCCT
CGAAGGCAAATATGCATGGCAATTCATTTGAGCGGAAGCTAGCTACCTTG
AAGGGAAAAACATCGACTGGAACTGCACCATCCAGAAATGCACTAAAACC
GCGCTCCAGGGATGCTACCCCAGATGGCTTAAGAAGCAGATCTAGCAGTT
CAAATGGATGGGAAAGAAGTTTTTCTCCAGCATCGACAGTATCAGGTTCA
CATTTGAAGTTTTCTGACAACTATAGTATATCCAGTCCAACTCCAGTTGC
CAGGAAGCTGTTTACGGGATCCTCTCCTTATCAAGATTCTCCCGTAGTAG
AGCCAAGCTCCCCTTCAACGAATGAGAATTCACACCAGATCGATGCAAAC
GAGACTAGTGCTAATTCATTAATATATCCTTATCAAAGATTGACAGTGTC
GTCAACTGAACCAGTCTCAGGCATAGATGTGACCAAAAGAGAGGCATACT
TGTCTGAGGAAGAGTTTGCAGAAAAAATTGGCATGCCAAAGGGGGCCTTC
TATAAACTACCTAAATGGAGACAAAACAAGCTCAAGATGGCAGTCGATCT
TTTTTAATCCGTGATATACTGACGATAACTTCTGCTTGAGTAAGTCTTGA
TTGATGACTATCTTCCGGCACCCCATTTTGTTATTAGCTGGAATGAAGGA
CCCTTCACTTACCAGTTATGTTCCAAAAATTGCATCTAATCTGTAGTCAT
TTCCCTGAGCTTATAATCTATTATAGTCTCTGTTTATGCATCTTCCGAGA
AATCAAAGTATTATGAAACACTAGTTTTCTATGGTTTTTGAAACATATAA
GTTGATCCTATGTTTCTTGTACTTTTAGTTATTGAATTGTACTAGGAAAC
CAGTTATGGAGGCTTTTTTTTGG
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR007122Villin/Gelsolin
IPR003128Villin_headpiece
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR007123Gelsolin-like_dom
IPR030010Villin-1-like_plant
Vocabulary: Molecular Function
TermDefinition
GO:0003779actin binding
Vocabulary: Biological Process
TermDefinition
GO:0007010cytoskeleton organization
GO:0051017actin filament bundle assembly