g.arboreum_cottongen_reftransV1_0010184, g.arboreum_cottongen_reftransV1_0010184 (contig) Gossypium arboreum

Overview
Nameg.arboreum_cottongen_reftransV1_0010184
Unique Nameg.arboreum_cottongen_reftransV1_0010184
Typecontig
OrganismGossypium arboreum (Tree cotton)
Sequence length2148
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr12chromosomeg.arboreum_cottongen_reftransV1_0010184:1..2148 .
Chr12:139234145..139240556 +
Homology
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A0B0N632_GOSAR (ABC transporter B family member 25 OS=Gossypium arboreum GN=F383_16500 PE=3 SV=1)

HSP 1 Score: 1233.01 bits (3189), Expect = 0.000e+0
Identity = 644/644 (100.00%), Postives = 644/644 (100.00%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGKKHSLDETSNSISSSGSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQAAAAVASSIAEESFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFSGKSSSSEIESVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI
Sbjct:    1 MGKKHSLDETSNSISSSGSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQAAAAVASSIAEESFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFSGKSSSSEIESVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 644          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A0D2VV40_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G038700 PE=3 SV=1)

HSP 1 Score: 1215.29 bits (3143), Expect = 0.000e+0
Identity = 634/644 (98.45%), Postives = 639/644 (99.22%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGK+ SLDETSNSIS+SGSER PLLNKEA+KQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNL TASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQAAAAVASSIAEESFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITG MTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEP+LFNCSIEENIAYGFSGKSSSSEIESVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLL +DGIYTALVRRQLQGPTTKI
Sbjct:    1 MGKEQSLDETSNSISNSGSERTPLLNKEASKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLATASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQAAAAVASSIAEESFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGFMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPVLFNCSIEENIAYGFSGKSSSSEIESVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLCKDGIYTALVRRQLQGPTTKI 644          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A061EFF8_THECC (Transporter associated with antigen processing protein 2 OS=Theobroma cacao GN=TCM_046755 PE=3 SV=1)

HSP 1 Score: 1050.81 bits (2716), Expect = 0.000e+0
Identity = 554/644 (86.02%), Postives = 598/644 (92.86%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGKK  LD TS SISSSGS R PLL KE +KQ N  Q+   P+SDLEQG+A E  NVGF RVF+LAKPDAGKI V T ALLIAST+NLLIPKYGGMIIDIVSRDIRTPEQQS+AL+A+K+TV YIVLIVV+GS+ T LR+WLFSSASERVVARLR+DLFSHLI QEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTA IGV FMFSSSWKLTLL+LA+VPV SVA+R+ GRYLKELSH TQAAAAVA+SIAEESFGAIRTVRSFAQE +AISNY+EKVDETL LGLKQAK+VGLFFGG+NAA T SV+ VV YGAYLTI G MT GSLTSFILYSLTVGSAVSSLSGLY+T MKAAGASRRVFQLLDRVSSMPKSGDK PEGNPDGDVEL DVWFAYPSRPS M+LKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGVPLVEISHE+LH+KVSIVSQEP+LFNCSIEENIAYGF+GK+SS+EIESVAKMANAH+FI+KFP+KY+TVVGERGLRLSGGQKQR+AIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTV+SAD+VAVIS+G+IAESGTHE+LL EDGIYTALVRRQLQG  TK+
Sbjct:    1 MGKKQHLDWTSKSISSSGSNRVPLLYKEKSKQANDHQSPNGPVSDLEQGDAAEVANVGFCRVFSLAKPDAGKIIVGTIALLIASTSNLLIPKYGGMIIDIVSRDIRTPEQQSDALKAIKDTVIYIVLIVVVGSLCTTLRAWLFSSASERVVARLRKDLFSHLIQQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTAFIGVGFMFSSSWKLTLLALAVVPVFSVAVRKFGRYLKELSHTTQAAAAVAASIAEESFGAIRTVRSFAQESYAISNYSEKVDETLNLGLKQAKVVGLFFGGLNAASTLSVIIVVIYGAYLTIMGFMTAGSLTSFILYSLTVGSAVSSLSGLYTTTMKAAGASRRVFQLLDRVSSMPKSGDKRPEGNPDGDVELNDVWFAYPSRPSHMVLKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVPLVEISHEFLHRKVSIVSQEPVLFNCSIEENIAYGFNGKASSAEIESVAKMANAHDFIEKFPDKYQTVVGERGLRLSGGQKQRVAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVKSADSVAVISDGQIAESGTHEELLSEDGIYTALVRRQLQGSNTKV 644          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A067K4V3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_19964 PE=3 SV=1)

HSP 1 Score: 1015.76 bits (2625), Expect = 0.000e+0
Identity = 534/644 (82.92%), Postives = 597/644 (92.70%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGKK  LD T+ SISSSGSER  LL KEA ++ N  Q+ + P +DLE G+A EA NVGF RVF+LAKPDAGK+ V T ALLIAST++LLIPK+GG+IIDIVSRDIRTPE+QSEA++ VKNT+  IVLIVVIGS+ TALR+WLF+SASERVVARLR++LF+HLI+QEIAFFDVTRTGELLSRLSEDTQ+IKNAATTNLSEALRN+TTA IGVAFMFSSSW LTLL+LA+VPVISVA+R+ GRYL++LSH+TQAAAAVA+SIAEESFGAIRTVRSFAQEG+AISNY+EKVDETL+LGL+QA++VGLFFGG+NAA T SV+ VV YGAYLTI G MT GSLTSFILYSLTVGS+VSSLSGLY+TAMKAAGASRRVFQLLDRVSSMPKSGDKCP  +PDGDVEL DVWFAYPSRPS M+LKGITLKL PGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGVPLVEISH YLH KVSIVSQEP+LFNCSIEENIAYGF+GK++SSEIE+VAKM+NAHEFI+KFPEKY+TVVGERGLRLSGGQKQR+AIARALLMNP++LLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTV+SAD VAVIS+G+IAESGTHE+LL +DGIYTALVRRQLQ P T I
Sbjct:    1 MGKKQQLDWTTKSISSSGSERVSLLTKEAQRKANEDQSPDGPPNDLELGDAVEATNVGFGRVFSLAKPDAGKLVVGTIALLIASTSSLLIPKFGGIIIDIVSRDIRTPEEQSEAIDDVKNTILEIVLIVVIGSLCTALRAWLFASASERVVARLRKNLFTHLINQEIAFFDVTRTGELLSRLSEDTQVIKNAATTNLSEALRNVTTALIGVAFMFSSSWNLTLLALAVVPVISVAVRKFGRYLRDLSHETQAAAAVAASIAEESFGAIRTVRSFAQEGYAISNYSEKVDETLKLGLRQARVVGLFFGGLNAASTLSVIIVVVYGAYLTIIGFMTAGSLTSFILYSLTVGSSVSSLSGLYTTAMKAAGASRRVFQLLDRVSSMPKSGDKCPVRDPDGDVELDDVWFAYPSRPSHMVLKGITLKLNPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVPLVEISHGYLHSKVSIVSQEPVLFNCSIEENIAYGFNGKANSSEIETVAKMSNAHEFIEKFPEKYQTVVGERGLRLSGGQKQRVAIARALLMNPRILLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVKSADIVAVISDGQIAESGTHEELLSKDGIYTALVRRQLQEPKTAI 644          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: B9IK93_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0017s13110g PE=3 SV=2)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 532/645 (82.48%), Postives = 593/645 (91.94%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLL-NKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGKK  LD TS SISSSGSER  LL +K+A +++N  ++ + P +DLE G   EA NVGF RVFALAKPDAGK+ V T ALLIAST++LLIPKYGGMIIDIVSRDI+TPEQQSEAL+AV NT+ YIVLIVV+GS+ TALR+WLFSSASERVVARLR+DLFSHLI+QEIAF+DVTRTGELLSRLSEDTQIIKNAATTNLSEA RNLTTA IGV FMFSSSWKLTLL+LAIVP+ISVA+++ GRYL+ELSH TQAAAAVA+SIAEESFGAIRTVRSFAQE F IS+Y+EKVDETL LGL+QA++VGLFFGG+NAA T SV+ VV YGAYLTITG MT GSLTSFILYSLTVGS+VSSLSGLY+TAMKAAGASRRVFQLLDR+SSMPKSGDKCP  + DGDVEL DVWFAYPSRPS M+LKGITLKL PGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGVPL EISH+YLH KVSIVSQEP+LFNCSIEENIAYG++GK+S ++IE+VAKMANAH+FID FPEKY+TVVGERGLRLSGGQKQR+AIARALLMNP+VLLLDEATSALDAESEYLVQDAMDSLM+GRTVLVIAHRLSTV+SADTVAVIS+G+IAESGTHE+LL +DGIY ALVRRQLQGP+T +
Sbjct:    1 MGKKEYLDWTSRSISSSGSERVSLLTSKDAKRKSNEGESPDGPATDLELGGGTEAANVGFSRVFALAKPDAGKLIVGTIALLIASTSSLLIPKYGGMIIDIVSRDIKTPEQQSEALDAVMNTILYIVLIVVVGSLCTALRAWLFSSASERVVARLRKDLFSHLINQEIAFYDVTRTGELLSRLSEDTQIIKNAATTNLSEAFRNLTTALIGVCFMFSSSWKLTLLALAIVPLISVAVKKFGRYLRELSHATQAAAAVAASIAEESFGAIRTVRSFAQEEFTISHYSEKVDETLMLGLRQARIVGLFFGGINAASTLSVIVVVVYGAYLTITGVMTTGSLTSFILYSLTVGSSVSSLSGLYTTAMKAAGASRRVFQLLDRISSMPKSGDKCPRSDLDGDVELNDVWFAYPSRPSHMVLKGITLKLSPGSKVALVGPSGGGKTTIANLIERFYDPLKGQILLNGVPLAEISHKYLHGKVSIVSQEPVLFNCSIEENIAYGYNGKASFADIENVAKMANAHDFIDAFPEKYQTVVGERGLRLSGGQKQRVAIARALLMNPRVLLLDEATSALDAESEYLVQDAMDSLMQGRTVLVIAHRLSTVKSADTVAVISDGQIAESGTHEELLNKDGIYNALVRRQLQGPSTAL 645          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A059ARH4_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I02042 PE=3 SV=1)

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 517/645 (80.16%), Postives = 593/645 (91.94%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQ-GPTTKI 2077
            MGKK  LD TS SI S+GSER  LLNK A K+   +Q+AE P+SDLE G+A EA NVGF+RV++LAKP+AGK+ + T ALLIAST+++LIP++GG IIDIVSR+I++PE+Q EAL AVKNT+  IVLIVVIG++ TALRSWLF+SASERVVARLR+DLFSHLIHQEIAF+DVTRTGELLSRLSEDTQ+IKNAAT NLSEALRNLTTA+IG+ FMF+SSWKL LL+LA+VPVISV +R+ GRYL+ELSH TQAAAAVA+SIAEESFGAIRTVRSFAQE +A SNY EKVDETL+LGL+QA+++GLFFGG+NAA T SV+ VV YGAYLTITG+MT GSLTSFILYSLTVGS+VSSLSGLY+TAMKAAGASRRVFQLLDRVSSMPKSGDKCP GNPDGDVEL DVWFAYPSRPS M+LKGITLK++PGSK+ALVGPSGGGKTTIANLIERFYDPLKG+++LNG+PLVE+SHEYLH K+SIVSQEPILFNCSIEENIAYG  G++S S+IE+ AKMANAH+FI+ FPEKY T+VGERGLRLSGGQKQR+AIARALLM+P+VLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTV+SADTVAV+S+G+IAESGTHE+LL +DGIYTALVRRQLQ GP T++
Sbjct:    1 MGKKQHLDWTSGSIMSAGSERVSLLNKGAKKKGKEEQSAEGPVSDLEFGDAVEAANVGFFRVYSLAKPEAGKLIIGTIALLIASTSSILIPRFGGTIIDIVSREIKSPEEQLEALNAVKNTILEIVLIVVIGALCTALRSWLFASASERVVARLRKDLFSHLIHQEIAFYDVTRTGELLSRLSEDTQVIKNAATNNLSEALRNLTTAAIGITFMFTSSWKLALLALAVVPVISVCVRKFGRYLRELSHSTQAAAAVAASIAEESFGAIRTVRSFAQESYATSNYAEKVDETLKLGLRQARVIGLFFGGLNAASTLSVVVVVVYGAYLTITGTMTAGSLTSFILYSLTVGSSVSSLSGLYTTAMKAAGASRRVFQLLDRVSSMPKSGDKCPIGNPDGDVELDDVWFAYPSRPSHMVLKGITLKMRPGSKIALVGPSGGGKTTIANLIERFYDPLKGKVMLNGIPLVEVSHEYLHSKISIVSQEPILFNCSIEENIAYGLKGRASFSDIENAAKMANAHDFIESFPEKYNTMVGERGLRLSGGQKQRVAIARALLMDPRVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVKSADTVAVVSDGQIAESGTHEELLSQDGIYTALVRRQLQEGPRTEV 645          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: B9T5L9_RICCO (Multidrug resistance protein, putative OS=Ricinus communis GN=RCOM_0048860 PE=3 SV=1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 531/644 (82.45%), Postives = 597/644 (92.70%), Query Frame = -3
Query:  146 MGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2077
            MGKK +LD TS SISSSGSER  LL+KEA ++ N  Q+ +   +DLE G+  EA NVGF RVF+LAKPDAGK+ V T ALLIAST++LLIPKYGGMIIDIVSRDI++PE+QSEAL+AVKNT+  IVLIVVIGSV TALR+WLF+SASERVVARLR++LFSHLI+QEIAFFDVTRTGELLSRLSEDTQ+IKNAATTNLSEALRN+TTA IGVAFMF+SSWKLTLL+LA+VP+IS+A+R+ GRY+++LSH TQAAAAVA+SIAEESFGAIRTVRSFAQE + IS Y+EKVDETL+LGL+QA++VGLFFGG+NAA T SV+ VV YGAYLTI GSMT GSLTSFILYSLTVGS+VSSLSGLY+TAMKAAGASRRVFQLLDR+SSMPKSGDKCP  +PDGDVEL DVWFAYPSRPS M+LKGITLKL PGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGVPLVEISHEYLH KVSIVSQEP+LFNCSIEENIAYGF+GK+SSS++E+VAKMANAHEFIDKFPEKY+TVVGERGLRLSGGQKQR+AIARALLMNPK+LLLDEATSALDAESEYLVQDAMDSLM+GRTVLVIAHRLSTV+SAD VAVIS+G+I ESGTHE+LLR+DGIYTALVRRQLQ P + +
Sbjct:    1 MGKKQNLDWTSRSISSSGSERVSLLSKEARRKANEDQSPDGSPNDLELGDGVEAANVGFGRVFSLAKPDAGKLAVGTIALLIASTSSLLIPKYGGMIIDIVSRDIKSPEEQSEALDAVKNTILDIVLIVVIGSVCTALRAWLFASASERVVARLRKNLFSHLINQEIAFFDVTRTGELLSRLSEDTQVIKNAATTNLSEALRNVTTALIGVAFMFTSSWKLTLLALAVVPLISIAVRKFGRYVRDLSHATQAAAAVAASIAEESFGAIRTVRSFAQESYTISRYSEKVDETLKLGLRQARVVGLFFGGLNAASTLSVIIVVVYGAYLTIIGSMTAGSLTSFILYSLTVGSSVSSLSGLYTTAMKAAGASRRVFQLLDRISSMPKSGDKCPIIDPDGDVELDDVWFAYPSRPSHMVLKGITLKLNPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVPLVEISHEYLHSKVSIVSQEPVLFNCSIEENIAYGFNGKASSSDVEAVAKMANAHEFIDKFPEKYQTVVGERGLRLSGGQKQRVAIARALLMNPKLLLLDEATSALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVKSADIVAVISDGQITESGTHEELLRKDGIYTALVRRQLQEPNSAL 644          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A061EGG5_THECC (Transporter associated with antigen processing protein 2 OS=Theobroma cacao GN=TCM_046754 PE=3 SV=1)

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 497/618 (80.42%), Postives = 562/618 (90.94%), Query Frame = -3
Query:  146 NKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVA---KMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 1990
            N   NG Q+   P+SDLEQGNA EA NVG  R F+LAKPDAGK+ V T ALL AST++LLIPKYGGMIIDIVSRDI+T EQQSEAL+A+KNT+TYI+LI+V GS+  A+++WLFSSA ER+VARLR++LFSHLIH EIAFFDVT  GELL+RLSEDTQIIKNAATTNLSEALRNLTT  IG+ FMFSSSWKLTLL+ A+VPVISVAIR+ GRYLK+LSH TQAAAA+++S AEESFGAIRT+RSFAQEG+AIS Y+EKVD+TL+LGL +AK+VGL+FGG+N A   SV+ VV YGAYLTI G MT GSLTSFILYSLTVGS+VSSLSG   +AMKAAG+SRR+FQLLDRVSSMPKSGDKCP GNPDGDVEL DVWFAYPS PS MILKG+TLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGVP+VEISH+YLH+KVS+VSQEPILFNCS+EENIAY F+GK+SS+E+ESVA   KMANAHEFI+KFPEKY+TVVGERGLRLSGGQKQR+AIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTV+SAD++AV+++G+IAE GTHE+LLR+DGIYTALVRRQLQGP T I
Sbjct:   19 NAHANGNQSPNRPVSDLEQGNAVEAPNVGLSRAFSLAKPDAGKLIVGTIALLTASTSSLLIPKYGGMIIDIVSRDIKTQEQQSEALDAIKNTITYILLIIVAGSLCRAVQAWLFSSAGERIVARLRKNLFSHLIHLEIAFFDVTSIGELLNRLSEDTQIIKNAATTNLSEALRNLTTFIIGIGFMFSSSWKLTLLASAVVPVISVAIRKFGRYLKQLSHTTQAAAALSASAAEESFGAIRTIRSFAQEGYAISKYSEKVDDTLKLGLIRAKVVGLYFGGLNVASKLSVIMVVIYGAYLTIMGFMTAGSLTSFILYSLTVGSSVSSLSGSDVSAMKAAGSSRRIFQLLDRVSSMPKSGDKCPVGNPDGDVELNDVWFAYPSSPSHMILKGLTLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVPVVEISHDYLHRKVSMVSQEPILFNCSVEENIAYRFNGKASSAEVESVAMVQKMANAHEFIEKFPEKYQTVVGERGLRLSGGQKQRVAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVKSADSIAVLADGQIAERGTHEELLRQDGIYTALVRRQLQGPNTNI 636          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: A0A061FXW8_THECC (Transporter associated with antigen processing protein 2 isoform 1 OS=Theobroma cacao GN=TCM_014301 PE=3 SV=1)

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 484/625 (77.44%), Postives = 565/625 (90.40%), Query Frame = -3
Query:  146 ERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2020
            ER PLL++   ++ N +      L+DLE G+A  A NV F RVF+LAKPDAGK+ +AT ALLIAST+++LIPK+GG IIDIVS DIRTPEQ++EAL AV+NT+  I LIVV+GSV TALR+WLFSSASERVVARLR++LFSHLI+QEIAF+D+TRTGELLSRLSEDTQIIKNAAT+NLSEALRNL+TA IG+ FMF++SWKLTLL+LA+VP ISVA+++ GR+L+ELSHKTQAAAA A+SI+EESFGAIRTVRSFAQEG+ I+ Y+EKVDETL LGLKQAK+VGLFFGG+NAA T SV+ VV YGA LTITGSMT G+LTSFILYSLTVGS+VS LSGLY+ AMKAAGASRRVFQLLDR SSMPKSG+KCP G+ DG+VEL DVWFAYPSRP+ M+LKGITLKL+PGSKVALVGPSGGGK+TIANLIERFYDP+KG+ILLNGVPLVEISHE+LH+K+SIVSQEP+LFNCSIEENIAYG  GK++ ++IE+ AKMANAHEFI KFP+KY+T VGERG+RLSGGQKQR+AIARALLM+PK+LLLDEATSALDAESEYLVQDAMDSLM+GRTVLVIAHRLSTVQ+ADTVAV+S+G++ ESGTHE+LL +DGIYTALVRRQLQ P   +
Sbjct:    7 ERTPLLDRGGRRKRN-ETLENDNLTDLEHGDAVPAANVSFTRVFSLAKPDAGKLILATIALLIASTSSILIPKFGGKIIDIVSGDIRTPEQKAEALTAVRNTILEIFLIVVVGSVCTALRAWLFSSASERVVARLRKNLFSHLINQEIAFYDITRTGELLSRLSEDTQIIKNAATSNLSEALRNLSTAFIGLGFMFATSWKLTLLALAVVPAISVAVQKFGRFLRELSHKTQAAAAAAASISEESFGAIRTVRSFAQEGYEITRYSEKVDETLNLGLKQAKVVGLFFGGLNAASTLSVIVVVIYGANLTITGSMTPGALTSFILYSLTVGSSVSGLSGLYTVAMKAAGASRRVFQLLDRSSSMPKSGNKCPLGDQDGEVELDDVWFAYPSRPNHMVLKGITLKLQPGSKVALVGPSGGGKSTIANLIERFYDPMKGKILLNGVPLVEISHEHLHRKISIVSQEPVLFNCSIEENIAYGCEGKANINDIENAAKMANAHEFISKFPDKYQTHVGERGVRLSGGQKQRVAIARALLMDPKILLLDEATSALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVQTADTVAVVSDGQVVESGTHEELLGKDGIYTALVRRQLQAPKANL 630          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Match: D7SIL4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g05120 PE=3 SV=1)

HSP 1 Score: 968.378 bits (2502), Expect = 0.000e+0
Identity = 486/625 (77.76%), Postives = 563/625 (90.08%), Query Frame = -3
Query:  146 ERAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI 2020
            ER PLL +E  ++ N        L+DLE G+A  A NVGF RV +LAKPDAGK+ +AT ALLIAST+++LIPK+GG IIDIVSR+I TPEQ++EAL AVKNT+  I LIV++GS+ TALR+WLFSSASERVVARLR++LFSHLI QEIAFFD+TRTGELLSRLSEDTQIIKNAATTNLSEALRNL+TA IG+ FMF++SWKLTLL+LAIVP ISVA+R+ GR+L+ELSHKTQAAAA+A+SIAEESFGAIRTVRSFAQE + IS Y+ +V+ETL LG+KQA++VGLFFGG+NAA T SV+ VV YGA LTI GSM+ G+LTSFILYSLTVGS+VS LSGLY+ AMKAAGASRRVFQLLDRVSSMPKSG+KCP G+ DG+VEL DVWFAYPSRP  M+LKGITLKL+PGSK+ALVGPSGGGKTTIANLIERFYDP+KG ILLNGVPLVEISHE+LH+K+SIVSQEP+LFNCSIEENIAYG+ GK+SS+++E+ AKMANAHEFI KF EKY+T VGERG+RLSGGQKQR+AIARALLMNP+VLLLDEATSALDAESEYLVQDAMDSLM+GRTVLVIAHRLSTV+SADTVAV+S+GEI ESGTH++LL +DGIYTALVRRQLQGP  ++
Sbjct:    8 ERVPLLGREGGRKRN-DTLVNGHLTDLEHGDAIPAANVGFCRVLSLAKPDAGKLVLATIALLIASTSSILIPKFGGKIIDIVSREIITPEQKTEALNAVKNTILEIFLIVIVGSICTALRAWLFSSASERVVARLRKNLFSHLIQQEIAFFDITRTGELLSRLSEDTQIIKNAATTNLSEALRNLSTAFIGLGFMFATSWKLTLLALAIVPAISVAVRKFGRFLRELSHKTQAAAALAASIAEESFGAIRTVRSFAQEAYEISRYSSQVEETLNLGIKQARVVGLFFGGLNAASTLSVIVVVIYGANLTINGSMSPGALTSFILYSLTVGSSVSGLSGLYTVAMKAAGASRRVFQLLDRVSSMPKSGNKCPLGDQDGEVELNDVWFAYPSRPDHMVLKGITLKLQPGSKIALVGPSGGGKTTIANLIERFYDPIKGRILLNGVPLVEISHEHLHRKISIVSQEPVLFNCSIEENIAYGYEGKASSADVENAAKMANAHEFISKFSEKYQTHVGERGVRLSGGQKQRVAIARALLMNPRVLLLDEATSALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVKSADTVAVVSDGEIVESGTHDELLDKDGIYTALVRRQLQGPRNEV 631          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: AB25B_ORYSJ (ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 478/620 (77.10%), Postives = 544/620 (87.74%), Query Frame = -3
Query:  158 RAPLLNKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGP 2017
            RAPLL          Q      LSDLE+G+  +  NVGF RV  LA+ DAGK+ +AT ALL+AS +N+L+PKYGG IIDIVSRD+R PE +++AL+ V  T+ YIV+IVV GSV TALR+WLF+SASERVVARLR+DLFSHL++QEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRN+TT SIG+ FMF++SWKLTLL+L IVPVIS+A+R+ GR+L+ELSH+TQAAAAVASSIAEESFGAIRTVRSFAQE   +  Y EKVDETL+LGLKQAK+VG+F GG+NAA T SV+ VV YGA LTI G MT GSLTSFILYSLTVGS+VS+LSGLY+T MKA+GASRRVFQLLDRVSSM  SGD+CP    DG+VEL DVWFAYPSRPS MILKGITLKL PGSKVALVGPSGGGKTTIANLIERFYDPLKG ILLNGVPL EISH++LH+KVSIVSQEP+LFNCSIEENIAYG  GK+SS+++E+ AKMANAH FI  FP++YKTVVGERG+RLSGGQKQR+AIARALLMNP+VLLLDEATSALDAESEYLVQDAMDSLM+GRTVLVIAHRLSTV+SADTVAVIS+G+I ESGTH++LL  DGIYTALV+RQLQGP
Sbjct:   12 RAPLL---------AQGETSRALSDLEEGSNVQPENVGFCRVIKLARHDAGKLVIATMALLVASLSNILVPKYGGKIIDIVSRDVRRPEDKAQALDDVTGTILYIVIIVVTGSVCTALRAWLFNSASERVVARLRKDLFSHLVNQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNITTTSIGLGFMFATSWKLTLLALVIVPVISIAVRKFGRFLRELSHQTQAAAAVASSIAEESFGAIRTVRSFAQESHEVLRYGEKVDETLKLGLKQAKVVGMFSGGLNAASTLSVVIVVIYGANLTINGYMTTGSLTSFILYSLTVGSSVSALSGLYTTVMKASGASRRVFQLLDRVSSMANSGDRCPTNENDGEVELDDVWFAYPSRPSHMILKGITLKLTPGSKVALVGPSGGGKTTIANLIERFYDPLKGRILLNGVPLPEISHQFLHRKVSIVSQEPVLFNCSIEENIAYGLEGKASSADVENAAKMANAHNFICSFPDQYKTVVGERGIRLSGGQKQRVAIARALLMNPRVLLLDEATSALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVKSADTVAVISDGQIVESGTHDELLSRDGIYTALVKRQLQGP 622          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: AB27B_ARATH (ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1)

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 492/623 (78.97%), Postives = 561/623 (90.05%), Query Frame = -3
Query:  152 RAPLL-NKEANKQTNGQQAAESPLSDLEQGNAEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTT 2017
            R PLL N+E   + NG   +E+ L+DLE G   EA NVGF RVFALAKPDAGK+ + T ALLI STTNLL+PK+GGMIIDIVSRD++TPEQQ+E+L AV+N V  I+LIVVIGS+ TALR+WLF+SASERVVARLR+DLF HL+HQEIAF+DVT+TGELLSRLSEDTQIIKNAATTNLSEALRN+TTA IGV FMF+SSWKLTLL+L +VPVISVA+++ GRYL+ELSH TQAAAAVA+SIAEESFGA+RTVRSFA+E + +S Y++KVDETL+LGLKQA LVGLFFGG+NAAFT SV+ VV YGAYLTI GSMTVG+LTSFILYSLTVGS+VSSLS LY+TAMKAAGASRRVFQ+LDRVSSM  SGDKCP GNPDGDVEL DVWFAYPSRPS MILKGI+L+L PGSKVALVGPSGGGKTTIANLIERFYDPLKG+ILLNGV L+EISH+YLHK++SIVSQEPILFNCS+EENIAYGF G++S ++IE+ AKMANAHEFI+ FP+KY TVVGERGLRLSGGQKQRIAIARALL NP VLLLDEATSALDAESEYLVQDAMDSLM GRTVLVIAHRLSTV++AD VAVIS+GE+AE GTH++LL  +GIYT LV+RQLQ  ++
Sbjct:   22 RDPLLQNQEDKPKANG---SENGLNDLEHG-VVEAANVGFGRVFALAKPDAGKLVIGTIALLIGSTTNLLVPKFGGMIIDIVSRDVKTPEQQTESLIAVRNAVVIILLIVVIGSICTALRAWLFNSASERVVARLRKDLFRHLMHQEIAFYDVTKTGELLSRLSEDTQIIKNAATTNLSEALRNVTTALIGVGFMFTSSWKLTLLALVVVPVISVAVKQFGRYLRELSHTTQAAAAVAASIAEESFGAVRTVRSFAKESYMVSQYSKKVDETLKLGLKQAVLVGLFFGGLNAAFTLSVITVVSYGAYLTIYGSMTVGALTSFILYSLTVGSSVSSLSSLYTTAMKAAGASRRVFQILDRVSSMSSSGDKCPVGNPDGDVELNDVWFAYPSRPSHMILKGISLRLTPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVSLMEISHQYLHKQISIVSQEPILFNCSVEENIAYGFDGEASFTDIENAAKMANAHEFIEAFPDKYNTVVGERGLRLSGGQKQRIAIARALLTNPSVLLLDEATSALDAESEYLVQDAMDSLMAGRTVLVIAHRLSTVKTADCVAVISDGEVAEKGTHDELLSLNGIYTNLVKRQLQSSSS 640          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB1_DICDI (ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 7.674e-161
Identity = 274/609 (44.99%), Postives = 406/609 (66.67%), Query Frame = -3
Query:  167 LSDLE-----QGNAEEAVN-------VGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIG-VAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLRE-DGIYTALVRRQL 1951
            LSD E     Q N E+ +N           R+  L++P+   I  A  AL+ +S T+L +P + G I+ +V+         + +   + ++   +V+I VIGS+ST +RSWLF  A ++ VAR+RR+LFS +++QEI +FD  RTGELLSRLS D+Q+I+N+ T N+S   R  T   IG V  +F ++W+LTLL L IVPV++++    G+ +K+L  + Q   A +S+  EE    IRTVRSF++E   I  Y++ ++ +  +G   A   G+F G V      +++ +V+ GA   + G+++ G LTSF+LY+L++  +++ +S L +  +KA G+S R+F++ DRV ++  SG K  + NP G++ELKDV F+YP+RP++ +LKG+ LKL  G+  ALVGPSGGGK+T+  +IERFYDP  G I  +G+ + E+   +    +  VSQEP+LF  SI++NI +G +  ++  +I S A+ ANAH FI++F   Y T+VGERG+RLSGGQKQR+AIARA++ NP +LLLDEATSALDAESEYLV+ A+D +M+ RTV+VIAHRLSTV +A+TV VI+ G+I E GTH++LL   DGIY  LV+RQL
Sbjct:  308 LSDKEKQFYNQSNEEKRLNKKVEVKHSNLKRLIQLSRPELPIILAAMVALVFSSLTSLAMPYFFGSIVQVVA--------TTHSFNNLNSSTLALVVIFVIGSISTLVRSWLFYLAGQKFVARIRRNLFSSIVNQEIGYFDQCRTGELLSRLSSDSQVIQNSVTVNISMLFR-YTIQIIGSVILLFITNWRLTLLMLGIVPVLAISTVVYGKKIKQLGKQFQDELAKSSTTGEEVISNIRTVRSFSKEQKFIDLYSKDINGSYLIGKSLAVATGVFSGIVFLVAQLAIVLIVYVGARQVLDGTLSTGDLTSFLLYTLSLAMSLAFISSLMTDFLKAIGSSDRIFEIFDRVPAINVSGGKQIQ-NPLGEIELKDVEFSYPTRPNNSVLKGLNLKLSKGTITALVGPSGGGKSTVIAMIERFYDPNSGSITFDGIDIKELDPVWYRGIIGYVSQEPVLFAGSIKDNITFG-NDSATMDQIISAAEKANAHSFIEEFENGYDTIVGERGVRLSGGQKQRVAIARAMIQNPMILLLDEATSALDAESEYLVKQAIDEIMKDRTVIVIAHRLSTVINANTVVVINQGKIEEMGTHKELLNNTDGIYHNLVKRQL 905          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCBA_MOUSE (ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 9.840e-152
Identity = 262/608 (43.09%), Postives = 383/608 (62.99%), Query Frame = -3
Query:  170 QQAAESPLSDLEQGNAEEAVNVG---FWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMP-KSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGF--XXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHED-LLREDGIYTALVRRQ 1972
            Q AA + + DL   +       G    W++  L +P+ G++  A   L ++S   +  P + G IID++  +    E   ++L  +   +T + L    G+ +  +R +L  S+ + +V RLR  LFS ++ QE+AFFD TRTGEL++RLS DT ++  + T NLS+ LR    AS+GV  MF  S  L    L++VP ISV     GRYL++LS  TQ + A A+ +AEE  G IRT+R+F +E   +  YT +VD+ LQL  K+A     FFG    +    V++V++ G  L  +  MTVG L+SF++Y+  VG ++  LS  YS  MK  GA  R+++LL+R   +P   G    E    G +E ++V F YP+RP   + +  +L +  GS  ALVGPSG GK+T+ +L+ R YDP  G + L+G  + +++  +L  K+  VSQEP+LF+CS+ ENIAYG       ++ ++E  A++ANA EFI  FP+ + TVVGE+G+ LSGGQKQRIAIARALL NPK+LLLDEATSALDAE+E+LVQ+A+D LM GRTVL+IAHRLST+++A+ VAV+ +G+I E GTHE+ LL+ +G+Y  L+ +Q
Sbjct:   96 QGAAATGVRDLGNDSQRRPAATGRSEVWKLLGLVRPERGRLSAAVGFLAVSSVITMSAPFFLGRIIDVIYTN--PSEGYGDSLTRLCAVLTCVFLC---GAAANGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYGRYLRKLSKATQDSLAEATQLAEERIGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALARAGFFGAAGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGLSIGGLSSFYSELMKGLGAGGRLWELLERQPRLPFNEGMVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPNSGTVSLDGHDIRQLNPVWLRSKIGTVSQEPVLFSCSVAENIAYGADNLSSVTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKGILLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLDHGKICEHGTHEELLLKPNGLYRKLMNKQ 698          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCBA_HUMAN (ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2)

HSP 1 Score: 453.751 bits (1166), Expect = 4.714e-147
Identity = 259/584 (44.35%), Postives = 372/584 (63.70%), Query Frame = -3
Query:  170 RVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVL----IVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMP-KSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGF--XXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLL-REDGIYTALVRRQ 1897
            ++  LA P+  ++  A   L ++S  ++  P + G IID++          +       + +T + L    + + G+ + A+R +L  ++ +R+V RLR  LFS ++ QE+AFFD TRTGEL++RLS DT ++  + T NLS+ LR    AS+G++ MF  S  L    L++VP +S+     GRYL++L+  TQ + A A+ +AEE  G +RTVR+F +E   I  Y  KVD  +QL  K+A     FFG    +    V++V++ G  L  +  MTVG L+SF++Y+  VG ++  LS  YS  MK  GA  R+++LL+R   +P   G    E +  G +E K+V FAYP+RP   I +  +L +  GS  ALVGPSG GK+T+ +L+ R YDP  G I L+G  + +++  +L  K+  VSQEPILF+CSI ENIAYG       ++ EI+ VA++ANA  FI  FP+ + TVVGE+G+ LSGGQKQRIAIARALL NPK+LLLDEATSALDAE+EYLVQ+A+D LM GRTVLVIAHRLST+++A+ VAV+  G+I E G HE+LL + +GIY  L+ +Q
Sbjct:  159 KLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVI---------YTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQ 733          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB9_HUMAN (ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 2.258e-134
Identity = 234/609 (38.42%), Postives = 358/609 (58.78%), Query Frame = -3
Query:  101 EEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIID-IVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI*FQNGKQGPYTCSAH 1924
            E+A      ++ +  KPD   +  A+F L++A+     +P Y G  ID IV +         ++++     V  + L+ +  S +  +R  +F+    R+  RLR  LF  L+ QE +FFD  RTG+L+SRL+ DT ++ +  + N++  LRN    +  V FMFS SW+L+L++    P+I +     G+Y K LS + Q A A AS+ AEE+  A++TVRSFA E      Y  K+ +  +L  K+A     +  G         +++++YG +L I+G MT G+L +FI+Y   +G  + S+  +YS  M+  GA+ +VF+ +DR  +M   G   P+ + +G V+ ++V F Y +RP   +L+ ++  L PG   ALVGPSG GK++  N++E FY    G +LL+G P+    H+YLH+ +S+VSQEP+LF  SI +NI+YG         +E+ A+ ANAH FI +  + Y T  GE+G +LSGGQKQR+A+ARAL+ NP VL+LDEATSALDAESEYL+Q A+   ++  TVL+IAHRLSTV+ A  + V+  G + + GTH+ LL + G+Y  LV+RQ+ G      F  G   P    +H
Sbjct:  167 EQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDGIVIQ---------KSMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPD-HLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEA-AQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSH 764          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB9_RAT (ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.315e-133
Identity = 230/609 (37.77%), Postives = 362/609 (59.44%), Query Frame = -3
Query:  101 AEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI*FQNGKQGPYTCSAH 1927
            AE+A      ++ +  KPD   +  A+F L++A+     +P Y G  ID +           ++++     V  + L+ +  S++  +R  +F+    R+  RLR  LF  L+ QE +FFD  RTG+L+SRL+ DT ++ +  + N++  LRN    +  V FMFS SW+L+L++    P+I +     G+Y K LS + Q+A A AS+ AEE+  A++TVRSFA E      +  K+ +  +L  K+A     +  G         +++++YG +L I+G M+ G+L +FI+Y   +G  + S+  +YS  M+  GA+ +VF+ +DR  +M   G   P+ + +G V+ ++V F Y +RP   +L+ ++  L PG   ALVGPSG GK++  N++E FY    G +LL+G P+    H+YLH+ +S+VSQEP+LF  SI +NI+YG         +E+ A+ ANAH FI +  + Y T  GE+G +LSGGQKQR+A+ARAL+ NP VL+LDEATSALDAESEYL+Q A+   ++  TVL+IAHRLSTV+ A  + V+  G + + GTH+ LL + G+Y  LV+RQ+ G    + +  G + P + + H
Sbjct:  162 AEQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQ--------KSMDQFTTAVVVVCLLAIGSSLAAGIRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARASTTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQVSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGRLAPD-HLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLQGGRVLLDGEPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEA-AQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLEHPLDYTAGHKEPPSNTEH 760          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB9_MOUSE (ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 7.659e-133
Identity = 229/609 (37.60%), Postives = 361/609 (59.28%), Query Frame = -3
Query:  101 AEEAVNVGFWRVFALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMPKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQLQGPTTKI*FQNGKQGPYTCSAH 1927
            AE+A      ++ +  KPD   +  A+F L++A+     +P Y G  ID +           ++++     V  + L+ +  S++  +R  +F+    R+  RLR  LF  L+ QE +FFD  RTG+L+SRL+ DT ++ +  + N++  LRN    +  V FMFS SW+L+L++    P+I +     G+Y K LS + Q+A A AS+ AEE+  A++TVRSFA E      +  K+ +  +L  K+A     +  G         +++++YG +L I+G M+ G+L +FI+Y   +G  + S+  +YS  M+  GA+ +VF+ +DR  +M   G   P+ + +G V+ ++V F Y +RP   +L+ ++  L PG   ALVGPSG GK++  N++E FY    G +LL+G P+    H+YLH+ +S+VSQEP+LF  SI +NI+YG         +E+ A+ ANAH FI +  + Y T  GE+G +LSGGQKQR+A+ARAL+ NP VL+LDEATSALDAESEYL+Q A+   ++  TVL+IAHRLSTV+ A  + V+  G + + GTH+ LL + G+Y  LV+RQ+ G    + +    + P + + H
Sbjct:  162 AEQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQ--------KSMDQFTTAVVVVCLLAIGSSLAAGIRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARASTTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQVSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPD-HLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLQGGRVLLDGKPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEA-AQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLEHPLDYTASHKEPPSNTEH 760          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB4_DICDI (ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 3.666e-124
Identity = 254/660 (38.48%), Postives = 392/660 (59.39%), Query Frame = -3
Query:  179 KEVRFPISGVFVVVSVLMGKKHSLDETXXXXXXXXSERAPLLNKEANKQTNG--QQAAESPLSD--LEQGNAEEAVN-VGFWRVFALAKPDAGKIFVATFALLIA---STTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLTTASIGVAFMFSSSWKLTLLSLAIVP-VISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSM-PKSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKVSIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALV 2128
            K++ F I G FV+  +   K             +  ++  +LN   +K  N    +  +S   D  +E+ + ++ +  +  +++F   K     I++  F ++ A   S   L IPK  G++ID           Q  A++A+         I++  +    L S + S A ER  ARLR  LF  ++ QEI FFD   TG+L++RLS D Q++++A   ++S  +++      GV  +   S KL+L  + I+P ++SV     G +LK LS ++Q A A ++ +AEE+ G IRTV++F+ + +    + EK   +L L  +    +G+F G  + A     + V +YG  L   G MT G LTSFI++++ + S+ S LS L++  M A G  +R+ +L++RV  +    G K  E    G+++  +V F YP+RP   +L G+ L LKPG  VAL G SGGGK+TIA L+ERFYD   G+I ++G  + +++ ++L  ++ IVSQEP LF  +I EN+ YG +  ++  EI   AK+ANAH+FI  FP+ Y+T+VGERG++LSGGQKQRIAIARA+L NP++++LDEATSALD++SE LVQ A+D+LM+GRT LVIAHRLSTVQ+AD + V+S+G+IAE G H +L+   G+Y  LV
Sbjct:  122 KDILFIIVGTFVIFKIYDNK------IGIVFCENEIDKETILNDPYDKIPNEIIVELKDSAKDDNIIEESDEDDGIKKISSFKLFF--KTIGNDIWLFGFGIITAFFSSWVGLQIPKVFGVLIDCTKNG---DSLQGPAIQAI--------FILLAQAGLNFLYSTMISVACERYSARLRSTLFGAMLEQEIGFFDQNSTGDLINRLSSDVQLVRSALKHSVSLGVKSFGQIVGGVISLILISPKLSLGMMTILPTMVSVGTFYAG-WLKSLSVRSQRAQAQSTIVAEEAIGNIRTVQAFSNQHYESERFIEKNQHSLALSTESGVQIGIFQGVTSLALNSVSLLVYWYGGTLVSRGEMTGGQLTSFIIHTMNMQSSFSQLSILFTQIMSAMGGMQRITELINRVPLINSNQGFKLRE--LKGEIKFINVDFKYPTRPHVHVLNGLNLTLKPGQVVALAGSSGGGKSTIAGLLERFYDISNGDITIDGYSIKQLNAKWLRSRIGIVSQEPSLFATTILENLRYG-NPNATEDEIIEAAKLANAHQFISNFPKGYETIVGERGVQLSGGQKQRIAIARAILKNPQIIILDEATSALDSQSELLVQTALDNLMKGRTTLVIAHRLSTVQNADLIGVLSHGKIAEFGNHNELMNHKGLYYKLV 758          
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Match: ABCB8_DANRE (ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.327e-121
Identity = 231/581 (39.76%), Postives = 350/581 (60.24%), Query Frame = -3
Query:  170 WRV-FALAKPDAGKIFVATFALLIASTTNLLIPKYGGMIIDIVSRDIRTPEQQSEALEAVKNTVTYIVLIVVIGSVSTALRSWLFSSASERVVARLRRDLFSHLIHQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLSEALRNLT-TASIGVAFMFSSSWKLTLLSLAIVPVISVAIRRLGRYLKELSHKTQXXXXXXXXXXXXSFGAIRTVRSFAQEGFAISNYTEKVDETLQLGLKQAKLVGLFFGGVNAAFTFSVMAVVFYGAYLTITGSMTVGSLTSFILYSLTVGSAVSSLSGLYSTAMKAAGASRRVFQLLDRVSSMP-KSGDKCPEGNPDGDVELKDVWFAYPSRPSDMILKGITLKLKPGSKVALVGPSGGGKTTIANLIERFYDPLKGEILLNGVPLVEISHEYLHKKV-SIVSQEPILFNCSIEENIAYGFXXXXXXXXXXSVAKMANAHEFIDKFPEKYKTVVGERGLRLSGGQKQRIAIARALLMNPKVLLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLSTVQSADTVAVISNGEIAESGTHEDLLREDGIYTALVRRQ 1900
            W V +   +P    +  A      A+  N+ IP   G ++++V+R +R  EQ    +  ++     ++ +  +  + T+    L S   ERV A +R  LF+ L+ Q+IAFFD  +TG+L++RL+ D Q  K++    +S+ LR+ T T    V+  F S  KLT L++ ++P +  A   +G +L++LS K Q   A A+ +A+E+ G +RTVR+FA E   +  Y  +V ++  +       + +F G  N      V+  +F G  L     ++ G L SF++ S TV  +++S+S L+   ++   A  RVF+ L    S+P   G + P  +  G V+  ++ F+YP+RP + ILK  +L L P   VA+VG SGGGK+T+A L+ERFYDP  G ++L+G+ +  +   +L   V   +SQEP+LF  S+ ENI +G    ++ +E+ S AK ANAH FI  F + Y TVVGERG+ LSGGQKQRIAIARAL+ NP +L+LDEATSALDAESE +VQ+A+D    GRTVL+IAHRLST+Q+AD + V+SNG I E+GTH +LL + G+Y  L++RQ
Sbjct:  132 WAVLWEFVRPQLFALMGAILLAFGAAALNIQIPLMLGDLVNVVARHMR--EQAGHYMRDIQAPAVKLLGLYALQGLLTSGYIILLSRVGERVAADMRTTLFTSLLRQDIAFFDANKTGQLVNRLTSDIQEFKSSFKLVISQGLRSATQTVGCFVSLYFISP-KLTGLTVVVLPCLVGAGALIGSFLRKLSRKAQEQVAKATGVADEALGNVRTVRAFAMEDRELEMYAAEVQKSAAMNETLGTGIAVFQGLSNIVLNCIVLGTIFAGGSLMARDDLSPGDLMSFLVASQTVQRSLASISILFGQMVRGMSAGARVFEYLALDPSVPLTGGGRIPLDSLMGRVDFMNISFSYPTRPGNQILKHFSLTLPPCKTVAIVGESGGGKSTVAALLERFYDPSSGVVMLDGLDIRTLDPSWLRGHVIGFISQEPVLFGTSVMENIRFG-KPSATDAEVVSAAKQANAHNFITGFADGYNTVVGERGVTLSGGQKQRIAIARALVKNPSILILDEATSALDAESERVVQEALDRATTGRTVLIIAHRLSTIQAADLICVMSNGRIVEAGTHLELLSKGGLYAELIKRQ 708          
The following BLAST results are available for this feature:
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy TrEMBL
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A0B0N632_GOSAR0.000e+0100.00ABC transporter B family member 25 OS=Gossypium ar... [more]
A0A0D2VV40_GOSRA0.000e+098.45Uncharacterized protein OS=Gossypium raimondii GN=... [more]
A0A061EFF8_THECC0.000e+086.02Transporter associated with antigen processing pro... [more]
A0A067K4V3_JATCU0.000e+082.92Uncharacterized protein OS=Jatropha curcas GN=JCGZ... [more]
B9IK93_POPTR0.000e+082.48Uncharacterized protein OS=Populus trichocarpa GN=... [more]
A0A059ARH4_EUCGR0.000e+080.16Uncharacterized protein OS=Eucalyptus grandis GN=E... [more]
B9T5L9_RICCO0.000e+082.45Multidrug resistance protein, putative OS=Ricinus ... [more]
A0A061EGG5_THECC0.000e+080.42Transporter associated with antigen processing pro... [more]
A0A061FXW8_THECC0.000e+077.44Transporter associated with antigen processing pro... [more]
D7SIL4_VITVI0.000e+077.76Putative uncharacterized protein OS=Vitis vinifera... [more]

Pages

back to top
BLAST of g.arboreum_cottongen_reftransV1_0010184 vs. ExPASy Swiss-Prot
Analysis Date: 2016-11-15 (Homology Analysis for Gossypium arboreum CottonGen RefTrans V1 vs SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
AB25B_ORYSJ0.000e+077.10ABC transporter B family member 25 OS=Oryza sativa... [more]
AB27B_ARATH0.000e+078.97ABC transporter B family member 27 OS=Arabidopsis ... [more]
ABCB1_DICDI7.674e-16144.99ABC transporter B family member 1 OS=Dictyostelium... [more]
ABCBA_MOUSE9.840e-15243.09ATP-binding cassette sub-family B member 10, mitoc... [more]
ABCBA_HUMAN4.714e-14744.35ATP-binding cassette sub-family B member 10, mitoc... [more]
ABCB9_HUMAN2.258e-13438.42ATP-binding cassette sub-family B member 9 OS=Homo... [more]
ABCB9_RAT1.315e-13337.77ATP-binding cassette sub-family B member 9 OS=Ratt... [more]
ABCB9_MOUSE7.659e-13337.60ATP-binding cassette sub-family B member 9 OS=Mus ... [more]
ABCB4_DICDI3.666e-12438.48ABC transporter B family member 4 OS=Dictyostelium... [more]
ABCB8_DANRE1.327e-12139.76ATP-binding cassette sub-family B member 8, mitoch... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis for Gossypium arboreum CottonGen RefTrans V1
Date Performed: 2016-11-14
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 426..627
e-value: 6.3E-18
score: 75.5
NoneNo IPR availablePIRSFPIRSF002773ABC_prm/ATPase_Bcoord: 5..644
e-value: 2.1E-245
score: 814.1
NoneNo IPR availableGENE3D1.20.1560.10coord: 62..378
e-value: 9.2E-90
score: 300.4
NoneNo IPR availablePANTHERPTHR24221FAMILY NOT NAMEDcoord: 1..645
NoneNo IPR availablePANTHERPTHR24221:SF127SUBFAMILY NOT NAMEDcoord: 1..645
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 302..330
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 92..122
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 222..241
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 123..143
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 242..301
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 144..221
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..70
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 71..91
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 342..362
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 331..341
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 363..645
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 74..91
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3D3.40.50.300coord: 399..631
e-value: 4.7E-82
score: 274.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 393..637
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 74..349
e-value: 6.5E-62
score: 209.5
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 75..365
score: 56.146
IPR011527ABC transporter type 1, transmembrane domainSUPERFAMILY90123ABC transporter transmembrane regioncoord: 62..379
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 417..567
e-value: 1.9E-34
score: 119.0
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 399..636
score: 26.497
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 539..553

Sequences
The following sequences are available for this feature:

contig sequence

>g.arboreum_cottongen_reftransV1_0010184 ID=g.arboreum_cottongen_reftransV1_0010184|Name=g.arboreum_cottongen_reftransV1_0010184|organism=Gossypium arboreum|type=contig|length=2148bp
AGAAGTATCCTACGAGTAGTCTTATAATGTCAGCAAGGGAACTATAATAT
ATGTAAAAATATATTTATGTTTTCTGACAATGCCAAGTATATAATATATG
GTGAGCAGAACAAGTATATGGACCTTGTTTACCATTTTGGAACTATATTT
TGGTGGTTGGTCCTTGTAGTTGCCTCCTAACAAGAGCTGTGTAGATACCA
TCCTCACGGAGAAGATCTTCATGTGTGCCACTTTCGGCTATCTCTCCGTT
GGATATGACGGCTACAGTGTCAGCACTTTGGACTGTTGATAGCCTGTGTG
CTATGACCAGAACAGTCCTACCCCTCATCAATGAATCCATGGCGTCCTGG
ACAAGGTATTCGCTTTCGGCATCCAGTGCACTTGTGGCTTCATCCAACAG
CAATACTTTTGGATTCATCAATAGTGCTCTCGCAATTGCTATTCTTTGCT
TCTGGCCTCCTGAGAGCCTCAAACCACGTTCTCCAACGACTGTTTTATAC
TTTTCCGGAAATTTATCTATGAATTCATGAGCATTAGCCATTTTAGCTAC
AGATTCTATTTCTGAACTGCTTGATTTTCCACTGAACCCGTAAGCGATGT
TCTCCTCTATAGAACAATTGAAAAGAATAGGTTCCTGGCTGACTATACTT
ACCTTTTTGTGAAGATATTCATGAGATATTTCCACTAAAGGAACTCCATT
TAACAAAATCTCTCCCTTCAAAGGATCGTAAAATCTCTCAATTAAGTTTG
CAATCGTGGTTTTTCCACCACCACTTGGTCCAACAAGGGCAACTTTCGAA
CCAGGTTTTAGTTTCAATGTTATTCCCTTTAGTATCATATCACTTGGTCG
AGAAGGATAAGCAAACCACACATCTTTCAATTCTACATCTCCATCGGGAT
TTCCTTCTGGACACTTGTCCCCGGATTTCGGCATGCTTGACACACGATCT
AAGAGCTGGAAAACCCTCCTACTTGCGCCTGCAGCTTTCATGGCAGTTGA
ATATAACCCGGACAAAGAGGAGACTGCAGATCCAACTGTGAGGCTATAGA
GGATGAAGGATGTGAGAGAACCCACAGTCATAGATCCTGTTATTGTCAAG
TAGGCACCATAGAACACTACGGCCATAACAGAAAATGTGAATGCAGCATT
TACTCCTCCAAAGAATAGACCAACTAGTTTAGCTTGTTTTAGTCCGAGCT
GCAGTGTCTCGTCAACTTTTTCGGTGTAATTCGATATTGCAAAACCTTCT
TGAGCAAATGATCTAACTGTTCGAATGGCTCCAAAAGATTCCTCAGCAAT
TGAGGATGCTACTGCAGCTGCTGCTTGTGTTTTGTGTGAAAGTTCCTTGA
GATAGCGTCCGAGTCTTCGTATAGCAACAGAAATAACCGGTACTATAGCC
AATGATAGCAACGTTAATTTCCAAGATGAAGAAAACATGAAGGCAACACC
AATAGAGGCGGTTGTTAGATTCCGGAGTGCCTCTGAAAGATTAGTTGTTG
CTGCATTTTTTATAATCTGGGTGTCCTCAGATAGCCTGCTGAGGAGTTCC
CCTGTTCGAGTAACATCAAAGAAGGCTATTTCCTGATGAATAAGATGACT
GAATAAGTCTCGCCTAAGGCGAGCTACAACCCTTTCACTGGCAGAAGAAA
AGAGCCATGACCGAAGTGCTGTGGACACAGACCCTATTACAACGATCAGC
ACAATGTATGTTACAGTATTCTTGACAGCTTCCAGGGCCTCTGATTGCTG
TTCAGGTGTCCTTATATCTCTTGAAACAATGTCTATGATCATTCCACCAT
ATTTAGGAATCAAGAGATTTGTAGTGGATGCTATCAATAATGCAAAGGTG
GCAACAAATATCTTCCCAGCATCTGGCTTTGCCAGTGCAAATACTCTCCA
AAATCCAACATTGACTGCCTCTTCTGCATTGCCTTGCTCAAGGTCTGACA
GAGGACTTTCAGCTGCTTGTTGCCCATTTGTTTGCTTATTTGCCTCCTTG
TTCAAAAGAGGTGCTCTTTCACTTCCAGAACTAGAAATGGAGTTTGAAGT
CTCATCTAAGCTATGTTTCTTCCCCATCAAAACACTCACCACAACAAAAA
CACCGGAAATGGGAAATCGGACTTCTTTTTATAAGATTTTGAGCAATT
back to top
Annotated Terms
The following terms have been associated with this contig:
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR011527ABC1_TM_dom
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016887ATPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral to membrane
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport